zenodorestricted
X-Ray diffraction images for a selenomethionyl derivative crystal of a Schistosoma japonicum Glutathione S-transferase expression tag
<p>Diffraction data were collected at beam line 24-ID-E of the Advanced Photon Source. This archive includes input and output files of the XDS data reduction program. Draft atomic coordinates have been deposited in the Protein Data Bank as entry 6N8U.</p> <p>Expected amino acid sequence:</p> <pre><code>MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSSMGSSHHHHHHSSGLVPR</code></pre> <p> </p>
ShareScore
16/100
Overall dataset sharing score
Score breakdown
These five areas show where the dataset supports — or may limit — practical reuse.
- Stewardship
- 8
- Harmonization
- 8
- Access
- 0
- Reuse readiness
- 0
- Engagement
- 0