Skip to main content
Powered by ShareScore

Find research datasets worth reusing

Search datasets from major research repositories and use ShareScore to quickly assess how well each record supports discovery, access, and reuse.

666

datasets available to search

ShareScore release 0.9.0

Reset

Dataset results

666 results for “Diffraction”

Learn how ShareScore rates datasets ↗
zenodo36/100

X-ray Diffraction Data for PDB ID 8VWR. Steroid Hydratase from Comamonas testosteroni

<p>X-ray diffraction data used for the structrual determination of steroid hydratase from Comamonas testosteroni, deposited in the PDB with the ID 8VWR.</p>

opencc-by-4.0Feb 2024View details →
zenodo36/100

Raw data files for the "The Mechanism of Rapid and Green Metal–Organic Framework Synthesis by In Situ Spectroscopy and Diffraction" manuscript

<p>All files are organized by figures in the main text of the original publication: https://doi.org/10.1021/acs.chemmater.4c00879, in the form of .csv files.</p>

opencc-by-4.0Jul 2024View details →
zenodo36/100

Single Crystal X-ray diffraction data for Mycobacterium tuberculosis BioA

<p>Single crystal X-ray diffraction data for MtBioA related to PDBID: xxxx</p> <p>Data collected at Diamond Light Source, UK</p> <p>Beamline I03</p>

opencc-by-sa-4.0Dec 2017View details →
zenodo36/100

Eiger HDF5 protein crystal diffraction images of TTR-Pt

<p>These data will be used during the&nbsp;Pasteur Course 3rd Integrative Structural Biology 2018 MX tutorials.</p> <p>The sequence of the protein is (127 amino acids, MW 13.76 kDa):</p> <p>&gt; TTR<br> GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT<br> TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYST<br> TAVVTNPKE</p> <p>&nbsp;</p> <p>There are 5 main platinum sites.</p>

opencc-by-sa-4.0Jul 2018View details →
zenodo36/100

Single Crystal X-ray Diffraction Data for PLP internal aldimine form of Sphingopyxis sp. MTA144 FumI protein

<p>Single Crystal X-ray Diffraction Data for PLP internal aldimine form of Sphingopyxis sp. MTA144 FumI protein collected at Diamond Light Source, Beamline I03 2018-07-21</p>

opencc-by-4.0Dec 2017View details →
zenodo36/100

Electron diffraction datasets from IRELOH and EPICZA

<p>Electron diffraction datasets of IRELOH (CDCC IREOLH01) and EPICZA (CDCC BISGAO), collected on a FEI Polara operated at 200 kV with a 512x512 pixels Timepix hybrid pixel detector (55x55 micron pixel size).&nbsp;</p>

opencc-by-sa-4.0Sep 2018View details →
zenodo36/100

Diffraction images of a crystal of a SH3 domain

<p>Data were collected on a single crystal at the beamline i03 of the Diamond synchrotron facility (Didcot, UK) using radiation of 0.99998&nbsp;&Aring; wavelength and a PILATUS3 6M detector. The dataset consists of 3600 images (0.1 degree oscillation per image). Data extend to ~1.1 &Aring; resolution.</p>

opencc-by-sa-4.0Dec 2017View details →
zenodo36/100

Raw diffraction images of SmgGDS-558 and farnesylated RhoA complex

<p>Diffraction images of SmgGDS-558 and farnesylated RhoA complex (PDB code: 5ZHX).<br> <br> Small and large wedge (1, 5, 180, 360, .. degrees per crystal) datasets&nbsp;were collected from beamlines BL41XU and BL44XU at SPring-8 and BL1A&nbsp;at Photon Factory.&nbsp;PILATUS3 6M (BL41XU), MX300-HS (BL44XU), and EIGER X 4M (BL1A) detectors were used at wavelengths of 0.9 and 1.0 &Aring;.</p> <p>The crystals belonged to space group P2<sub>1</sub>2<sub>1</sub>2<sub>1</sub> with unit cell parameters&nbsp;a=93.3, b=181.8, c=205.3 &Aring;.<br> <br> Electron density maps from various combinations of datasets were&nbsp;evaluated through KAMO, and finally data from 20161010_BL44XU/kozo0001 were merged and used for structural refinement at 3.5 &Aring; resolution.<br> <br> Note that the master.h5 files were modified; see<br> <a href="https://github.com/keitaroyam/yamtbx/blob/master/doc/eiger-en.md">https://github.com/keitaroyam/yamtbx/blob/master/doc/eiger-en.md</a></p>

opencc-by-4.0Sep 2018View details →
zenodo36/100

Raw diffraction images of Chrimson

<p>Chrimson is a red-shifted channelrhodopsin from the algae&nbsp;<em>Chlamydomonas noctigama</em>. The crystals were obtained within the&nbsp;lipidic cubic phase (LCP).<br> <br> 45 small-wedge (10 or 20&deg;/crystal) and 8 helical (50-100&deg;/crystal)&nbsp;datasets collected from loop-harvested microcrystals using EIGER X 9M&nbsp;detector at a wavelength of 1 &Aring; on BL32XU, SPring-8. The crystals&nbsp;belonged to space group P2<sub>1</sub>2<sub>1</sub>2<sub>1</sub> with unit cell parameters a=61.0,&nbsp;b=81.4, c=170.1 &Aring;. 13 datasets were merged at 2.6 &Aring; resolution in the&nbsp;published result (Nature Comm., 2018; PDB code: 5ZIH) using KAMO; see processing&nbsp;note&nbsp;<a href="https://github.com/keitaroyam/yamtbx/wiki/Processing-Chrimson-data-(5ZIH)">https://github.com/keitaroyam/yamtbx/wiki/Processing-Chrimson-data-(5ZIH)</a></p>

opencc-by-4.0Sep 2018View details →
zenodo36/100

Silicon Single Crystal Diffraction Pattern

<p>Single crystal silicon pattern, as used in AstroEBSD (https://arxiv.org/abs/1804.02602).</p> <p>The pattern can be indexed with a pattern centre of [0.5, 0.18, 0.62] (PCx, PCy, PCz - using AstroEBSD conventions) and it will return Euler angles of (-47.7, 73.9, -71.9) in degrees with a ZXZ convention. This is shown in figure 9 of the AstoEBSD paper.</p>

opencc-by-4.0Oct 2018View details →
zenodo36/100

Raw diffraction images of cypovirus polyhedra crystals containing Pd(allyl) complexes

<p>Diffraction images of wild type cypovirus polyhedra in-vivo crystals (WTPhC) and the mutant (&Delta;3-PhC) related to PDB codes <a href="https://www.rcsb.org/structure/5YHA">5YHA</a> and <a href="https://www.rcsb.org/structure/5YHB">5YHB</a>, respectively (<a href="http://dx.doi.org/10.1039/c7cp06651a">Abe et al., 2017, Phys. Chem. Chem. Phys.</a>).</p> <p>Small-wedge (5&deg; or 10&deg;/crystal) datasets were collected from loop-harvested microcrystals automatically with ZOO system using EIGER X 9M detector at a wavelength of 1 &Aring; on BL32XU, SPring-8.</p> <p>The crystals belonged to space group I23 with unit cell parameter a~103 &Aring;. All datasets were processed and merged using KAMO pipeline with XDS.</p> <p>NOTE that master.h5 files were modified; see <a href="https://github.com/keitaroyam/yamtbx/blob/master/doc/eiger-en.md">https://github.com/keitaroyam/yamtbx/blob/master/doc/eiger-en.md</a>.</p>

opencc-by-4.0Jan 2018View details →
zenodo36/100

Raw diffraction images of cross-linked cypovirus polyhedra mutant crystals

<p>Diffraction images of cross-linked cypovirus polyhedra mutant crystals related to PDB codes <a href="https://www.rcsb.org/structure/5YR1">5YR1</a>, <a href="https://www.rcsb.org/structure/5YR9">5YR9</a>, <a href="https://www.rcsb.org/structure/5YRA">5YRA</a>, <a href="https://www.rcsb.org/structure/5YRB">5YRB</a>, <a href="https://www.rcsb.org/structure/5YRC">5YRC</a>, and <a href="https://www.rcsb.org/structure/5YRD">5YRD</a> (<a href="http://dx.doi.org/10.1039/c7cc08689j">Negishi et al. 2018, Chem. Commun.</a>).</p> <p>Small-wedge (5&deg; or 10&deg;/crystal) datasets were collected from loop-harvested microcrystals at a wavelength of 1 &Aring; on BL32XU and BL41XU, SPring-8. The datasets for 5YR1, 5YR9, 5YRB, and 5YRC were collected automatically using ZOO system.</p> <p>The crystals belonged to space group I23 with unit cell parameter a~103 &Aring;. All datasets were processed and merged using KAMO pipeline with XDS.</p> <p>This entry includes following data:</p> <ul> <li> <p>1-PhC (5YR1, 1.72 &Aring;)</p> <ul> <li> <p>BL32XU (EIGER X 9M)</p> </li> <li> <p>5&deg;/crystal &times;32 (0.1&deg;/frame)</p> </li> </ul> </li> <li> <p>2-PhC (5YR9, 1.70 &Aring;)</p> <ul> <li> <p>BL32XU (MX-225HS)</p> </li> <li> <p>5&deg;/crystal &times; 127 (1&deg;/frame)</p> </li> </ul> </li> <li> <p>3-PhC (5YRA, 1.79 &Aring;)</p> <ul> <li> <p>BL41XU (PILATUS3 6M)</p> </li> <li> <p>5&deg; or 10&deg;/crystal &times; 49 (0.25&deg;/frame)</p> </li> </ul> </li> <li> <p>ox1-PhC (5YRB, 1.65 &Aring;)</p> <ul> <li> <p>BL32XU (EIGER X 9M)</p> </li> <li> <p>5&deg;/crystal &times; 78 (0.1&deg;/frame)</p> </li> </ul> </li> <li> <p>ox2-PhC (5YRC, 1.67 &Aring;)</p> <ul> <li> <p>BL32XU (MX-225HS)</p> </li> <li> <p>5&deg;/crystal &times; 323 (1&deg;/frame)</p> </li> </ul> </li> <li> <p>ox3-PhC (5YRD, 1.85 &Aring;)</p> <ul> <li> <p>BL41XU (PILATUS3 6M)</p> </li> <li> <p>5&deg;/crystal &times; 29 (0.25&deg;/frame)</p> </li> </ul> </li> </ul> <p>NOTE that EIGER&#39;s master.h5 files were modified; see <a href="https://github.com/keitaroyam/yamtbx/blob/master/doc/eiger-en.md">https://github.com/keitaroyam/yamtbx/blob/master/doc/eiger-en.md</a>.</p>

opencc-by-4.0Feb 2018View details →
zenodo36/100

Raw diffraction images of human muscarinic acetylcholine receptor

<p>Raw data for&nbsp;<a href="https://www.rcsb.org/structure/5ZK8">5ZK8</a>&nbsp;(M<sub>2</sub>-BRIL&ndash;NMS),&nbsp;<a href="https://www.rcsb.org/structure/5ZKC">5ZKC</a>&nbsp;(S110R-BRIL&ndash;NMS),&nbsp;<a href="https://www.rcsb.org/structure/5ZKB">5ZKB</a>(S110R-BRIL&ndash;AF-DX 384), and&nbsp;<a href="https://www.rcsb.org/structure/5ZK3">5ZK3</a>&nbsp;(S110R-BRIL&ndash;QNB).&nbsp;</p>

opencc-by-4.0Nov 2018View details →
zenodo36/100

Raw diffraction images of plant vacuolar iron transporter VIT1 (with Zn and Co)

<p>Diffraction images of full-length VIT1 related to PDB codes <a href="https://www.rcsb.org/structure/6IU3">6IU3</a>&nbsp;(Zn-bound) and <a href="https://www.rcsb.org/structure/6IU4">6IU4</a> (Co-bound). All data were collected from&nbsp;loop-harvested (micro)crystals on BL32XU, SPring-8 using EIGER X 9M detector.<br> <br> 6IU3: Helical (20, 45, or 90&deg;/crystal) datasets were collected&nbsp;automatically using ZOO system at a wavelength of 1 &Aring;.<br> 6IU4: Small-wedge (10&deg;/crystal) and helical (120&deg;/crystal) datasets were collected at a wavelength of 1.28 &Aring;.<br> <br> The crystals belonged to space group <em>C</em>222<sub>1</sub> with unit cell parameter&nbsp;a~47, b~290, c~46 &Aring;. All datasets were processed and merged using KAMO&nbsp;pipeline with XDS.</p> <p>Related entries:&nbsp;<a href="https://zenodo.org/record/2532134">metal binding domain</a>, <a href="https://zenodo.org/record/2532138">data for phasing&nbsp;by Hg-SIR</a>&nbsp;<br> &nbsp;</p>

opencc-by-4.0Feb 2019View details →
zenodo36/100

Raw diffraction images of plant vacuolar iron transporter VIT1 (metal binding domain)

<p>Diffraction images of the metal binding domain of&nbsp;VIT1&nbsp;related to PDB&nbsp;codes <a href="http://www.rcsb.org/structure/6IU5">6IU5</a> (Zn-bound), <a href="http://www.rcsb.org/structure/6IU6">6IU6</a> (Ni-bound), <a href="http://www.rcsb.org/structure/6IU8">6IU8</a> (Co-bound), and <a href="http://www.rcsb.org/structure/6IU9">6IU9</a>&nbsp;(Fe-bound).</p> <p>Helical data (180&deg;/crystal) were collected from&nbsp;loop-harvested crystals on BL41XU, SPring-8 at the peak and low-remote&nbsp;wavelengths of specific metals (Zn: 1.2820/1.3000; Ni: 1.4850/1.5220;&nbsp;Co: 1.6050/1.6480; Fe: 1.74009/1.79148 &Aring;).</p> <p>The crystals belonged to space group <em>P</em>3<sub>1</sub> with unit cell parameter a~85, c~98 &Aring;.</p> <p>Related entries:&nbsp;<a href="https://zenodo.org/record/2532136">full-length with Co/Zn</a>, <a href="https://zenodo.org/record/2532138">full-length data for phasing&nbsp;by Hg-SIR</a></p>

opencc-by-4.0Feb 2019View details →
zenodo36/100

Raw diffraction images of plant vacuolar iron transporter VIT1 (phasing data by Hg-SIR)

<p>Diffraction images of full-length VIT1 for Hg-SIR phasing. All data&nbsp;were collected from loop-harvested crystals on BL32XU, SPring-8 at a&nbsp;wavelength of 1 &Aring; using the EIGER X 9M detector.</p> <p>For Hg-bound VIT1, six helical (71-210&deg;/crystal) datasets were&nbsp;collected. From native (without Hg) crystals, 24 helical&nbsp;(20-90&deg;/crystal) datasets were automatically collected.&nbsp;The crystals belonged to space group <em>C</em>222<sub>1</sub> with unit cell parameter a~47, b~290, c~46 &Aring;.</p> <p>Related entries:&nbsp;<a href="https://zenodo.org/record/2532136">full-length with Co/Zn</a>,&nbsp;<a href="https://zenodo.org/record/2532134">metal binding domain</a><br> &nbsp;</p>

opencc-by-4.0Feb 2019View details →
zenodo36/100

Single crystal diffraction raw data for Fampridine hydrochloride Phase 3

<p>A set of diffraction images (in both Denzo .x and Bruker Nonius .kcd formats) collected on a Bruker Nonius KappaCCD diffractometer on an FR591 rotating anode generator equipped with confocal mirrors.</p> <p>The sample is Phase 3 of the Fampridine hydrochloride organic salt - a system that forms numerous complicated phases. The authors wish to make the raw data available so that those who wish to explore the modelling of these exceptionally complex systems may process the data themselves.</p>

opencc-by-4.0Dec 2018View details →
zenodo36/100

Single crystal diffraction raw data for Fampridine hydrochloride Phase 4

<p>A set of diffraction images in Rigaku Oxford Diffraction (img) format, collected on a Rigaku FRE+ diffractometer, equipped with HF Varimax confocal mirrors and an AFC12 goniometer and HG Saturn 724+ detector diffractometer.</p> <p>The sample is Phase 4 of the Fampridine hydrochloride organic salt - a system that forms numerous complicated phases. The authors wish to make the raw data available so that those who wish to explore the modelling of these exceptionally complex systems may process the data themselves.</p>

opencc-by-4.0Dec 2018View details →
zenodo36/100

Single crystal diffraction raw data for Fampridine hydrochloride Phase 1

<p>A set of diffraction images (in both Denzo .x and Bruker Nonius .kcd formats) collected on a Bruker Nonius KappaCCD diffractometer on an FR591 rotating anode generator equipped with confocal mirrors.</p> <p>The sample is Phase 1 of the Fampridine hydrochloride organic salt - a system that forms numerous complicated phases. The authors wish to make the raw data available so that those who wish to explore the modelling of these exceptionally complex systems may process the data themselves.</p>

opencc-by-4.0Dec 2018View details →
zenodo36/100

Raw diffraction images of Ferroportin homologue (phasing data by Hg-SIRAS)

<p>Diffraction images of native and&nbsp;mercury-bound Ferroportin&nbsp;homologue from&nbsp;Bdellovibrio bacteriovorus. This phase information was used for PDB entries&nbsp;<a href="http://www.pdb.org/pdb/search/structidSearch.do?structureId=5AYM">5AYM</a>&nbsp;and&nbsp;<a href="http://www.pdb.org/pdb/search/structidSearch.do?structureId=5AYN">5AYN</a>, and indirectly&nbsp;<a href="http://www.pdb.org/pdb/search/structidSearch.do?structureId=5AYO">5AYO</a>&nbsp;(<a href="https://doi.org/10.1038/ncomms9545">Taniguchi et al. 2015</a>). All data&nbsp;were collected from loop-harvested crystals on BL32XU, SPring-8 at a wavelength of&nbsp;1.00000 &Aring; using the MX225HS&nbsp;CCD detector.</p> <p>From a native crystal, a helical (180&deg;/crystal, 1&deg;/frame) datasets were&nbsp;collected using 12&times;8&nbsp;&mu;m<sup>2</sup> beam.&nbsp;From a mercury-derivative crystals,&nbsp;two helical&nbsp;(180&deg;/crystal, 1.5&deg;/frame) datasets were collected using 10&times;2&nbsp;&mu;m<sup>2</sup> beam.&nbsp;The crystals belonged to space group&nbsp;<em>P</em>2<sub>1</sub>2<sub>1</sub>2<sub>1</sub>&nbsp;with unit cell parameter a~57, b~86,&nbsp;c~96 &Aring;.</p>

opencc-by-4.0Oct 2015View details →

ScienceDex guides

Understand access before you commit

These curated guides explain access requirements, typical timelines, costs, and reuse considerations for widely used research datasets.

Compare curated datasets

Allen Brain Atlas

Allen Brain Atlas is an Allen Institute collection of brain map atlases, datasets, APIs, and analysis tools covering mouse, human, and non-human primate brain resources.

allen-brain-atlas
neuroscienceopenDocumentation, web resources, and API references are available online.
Last verified 2026-04-30Open record

Annotated Behaviour and Observability Dataset (ABODe)

ABODe is a University of Edinburgh DataShare dataset for behavior classification in group-housed mice using home-cage video, identities, bounding boxes, ground-plate positions, and annotator labels.

abode-home-cage
behavioral-neuroscienceopenThe DataShare record exposes download links for annotations, documentation, license text, and the zipped per-snippet data directory.
Last verified 2026-04-30Open record

DANDI Archive for NWB datasets

DANDI is a BRAIN Initiative archive for publishing and sharing neurophysiology data, including electrophysiology, optophysiology, and behavioral data packaged as NWB and related standards.

dandi-nwb
electrophysiologyopenPublished Dandiset metadata and archive endpoints are available through the production DANDI API.
Last verified 2026-04-30Open record

International Brain Laboratory public data

The International Brain Laboratory public data releases expose standardized mouse decision-making experiments, including Neuropixels recordings, widefield calcium imaging, behavior, and session metadata accessed through the ONE API.

ibl
behavioral-neuroscienceopenPublic sessions can be searched and loaded from the IBL public data server through ONE.
Last verified 2026-04-29Open record

OpenNeuro

OpenNeuro is a free, open platform for sharing neuroimaging datasets, with public search, dataset pages, and download paths for web, S3, DataLad, and the OpenNeuro CLI.

openneuro
neuroscienceopenPublished datasets are available on demand over the internet.
Last verified 2026-04-29Open record