Skip to main content
Powered by ShareScore

Find research datasets worth reusing

Search datasets from major research repositories and use ShareScore to quickly assess how well each record supports discovery, access, and reuse.

86

datasets available to search

ShareScore release 0.9.0

Reset

Dataset results

86 results for “HDF5”

Learn how ShareScore rates datasets ↗
zenodo36/100

DMC sCMOS 8-bit preview of 16-bit HDF5 dataset

<p>Preview video of https://zenodo.org/record/570045.  16-bit data -&gt; 8-bit FFV1 AVI</p> <p>Filename is a mistake, it's 2012 december 25</p> <p>Elapsed time activity (note, video is comprised of several time cuts of activity in the night)</p> <p>video has not been altered except for scaling to 8-bit with auto-contrast set every 100 frames or so.</p> <p>5:50-6:40 flaming/dispersive</p> <p>7:30-8:20  kelvin helmholtz swirls of various sizes and intensities</p> <p>9:50-10:55  kinking, folding</p> <p>11:20-14:00  kelvin helmholtz from small to huge, slow to fast, "blowing smoke" like swirls</p> <p>14:00-14:30 kelvin helmholtz swirls with flickering</p> <p>17:00-18:00  faint wisps of kelvin helmholts</p> <p>32:45-37:00   more kelvin helmholtz of various scales</p> <p>50:32- 1:21:30   Is this wispy clouds or light/faint aurora with dark patterns?</p> <p>1:33:13, 1:35:05, 1:38:40 satellite pass and 1:39:15, 1:42:33, 1:43:13, 1:45:25, 1:47:40</p>

opencc-by-4.0Dec 2012View details →
zenodo36/100

IFC HDF5 Building Models

<p>This is a set of building models to assess the implications of a binary HDF5-based serialization for Industry Foundation Classes (IFC) building models. This serialization is based on ISO 10303-26, but includes additional profiles tailored to use cases in the building industry.</p>

opencc-by-4.0Feb 2018View details →
zenodo36/100

Eiger HDF5 protein crystal diffraction images of TTR-Pt

<p>These data will be used during the&nbsp;Pasteur Course 3rd Integrative Structural Biology 2018 MX tutorials.</p> <p>The sequence of the protein is (127 amino acids, MW 13.76 kDa):</p> <p>&gt; TTR<br> GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT<br> TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYST<br> TAVVTNPKE</p> <p>&nbsp;</p> <p>There are 5 main platinum sites.</p>

opencc-by-sa-4.0Jul 2018View details →
zenodo36/100

nSOLT first paper v1.5.2 figure data HDF5

<p>Data for the figures in the manuscript, &quot;A reduced model of neutral-plasma interactions in the edge and scrape-off-layer: verification comparisons with kinetic Monte Carlo simulations&quot; in HDF5 format.E</p>

opencc-by-4.0Aug 2018View details →
zenodo32/100

HDF5 JetClass

<p>HDF5 version of JetClass. Do not use the key "Pmu_cyl". It is incorrect.</p>

opencc-by-4.0Jun 2024View details →
zenodo32/100

3D HDF5 data from numerical relativity simulations

<p>3D HDF5 data from numerical relativity simulations. Test data for visualization purposes.</p>

opencc-by-4.0Jul 2021View details →
zenodo32/100

ENDF/B-VIII.0 HDF5 library for OpenMC with cross sections at 20 K

<p>This archive contains a processed ENDF/B-VIII.0 HDF5 library for use with the <a href="https://github.com/openmc-dev/openmc">OpenMC</a> Monte Carlo particle transport code. Neutron cross sections are present at temperatures of 20, 294, and 600 K.</p>

opencc-by-4.0Oct 2023View details →
zenodo28/100

alpha Synuclein PIFE HDF5 files and analyses

<p>smPIFE measurements of the alpha Synuclein monomer and of ssDNA &amp; dsDNA - analysis documentation (Jupyter notebook) and raw data files (photon HDF5).</p>

opencc-by-4.0Oct 2020View details →
zenodo28/100

HDF5 JetClass train4

Open the record for dataset details and reuse information.

opencc-by-4.0Jun 2024View details →
zenodo28/100

HDF5 JetClass train3

Open the record for dataset details and reuse information.

opencc-by-4.0Jun 2024View details →
zenodo28/100

HDF5 JetClass train2

Open the record for dataset details and reuse information.

opencc-by-4.0Jun 2024View details →
zenodo28/100

HDF5 JetClass train1

Open the record for dataset details and reuse information.

opencc-by-4.0Jun 2024View details →
zenodo28/100

HDF5 JetClass3

Open the record for dataset details and reuse information.

opencc-by-4.0Jun 2024View details →
zenodo28/100

HDF5 JetClass1

Open the record for dataset details and reuse information.

opencc-by-4.0Jun 2024View details →
zenodo28/100

HDF5 JetClass2

Open the record for dataset details and reuse information.

opencc-by-4.0Jun 2024View details →
zenodo28/100

HDF5 JetClass4

Open the record for dataset details and reuse information.

opencc-by-4.0Jun 2024View details →
zenodo28/100

Hdf5 input files for FICOS simulator

<p>This resource contains the hdf5 input files needed by the FICOS water quality simulator. To use them with the ficosUQ package, download the files below and place them in the ficosUQ/data folder:</p> <ul> <li>hd_files.hdf5 : Boundary conditions.</li> <li>hd_files_ma_5.hdf5 : Boundary conditions with moving average smoothing for solar radiation.</li> <li>loading.hdf5 : Nutrient loadings.</li> <li>loading_Aurajoki.hdf5 : Nutrient loadings based on the Aurajoki basin.</li> </ul>

opencc-by-4.0Nov 2024View details →
nasa28/100

ASTER Global Emissivity Dataset, 1 kilometer, HDF5 V003

The Terra Advanced Spaceborne Thermal Emission and Reflection Radiometer (ASTER) Global Emissivity Dataset (GED) land surface temperature and emissivity (LST&E) data products are generated using the ASTER Temperature Emissivity Separation (TES) algorithm with a Water Vapor Scaling (WVS) atmospheric correction method using Moderate Resolution Imaging Spectroradiometer (MODIS) MOD07_L2 atmospheric profiles and the MODerate Spectral resolution TRANsmittance (MODTRAN 5.2) radiative transfer model. This dataset is computed from all clear-sky pixels of ASTER scenes acquired from 2000 through 2008. The National Aeronautics and Space Administration’s (NASA) Jet Propulsion Laboratory (JPL), California Institute of Technology, developed the ASTER GED product.Known Issues* Known issues are provided in Section 4 of the User Guide.Improvements/Changes from Previous Versions* Includes data for the entire globe.* Includes the mean climatology of all ASTER data for the specific temporal extent.

restrictednotspecifiedApr 2025View details →
nasa28/100

ASTER Global Emissivity Dataset, 100 meter, HDF5 V003

Advanced Spaceborne Thermal Emission and Reflection Radiometer (ASTER) Global Emissivity Dataset (GED) land surface temperature and emissivity (LST&E) data products are generated using the ASTER Temperature Emissivity Separation (TES) algorithm with a Water Vapor Scaling (WVS) atmospheric correction method using Moderate Resolution Imaging Spectroradiometer (MODIS) MOD07_L2 atmospheric profiles and the MODerate spectral resolution TRANsmittance (MODTRAN 5.2 radiative transfer model). This dataset is computed from all clear-sky pixels of ASTER scenes acquired from 2000 through 2008. AG100 data are available globally at spatial resolution of 100 meters.The National Aeronautics and Space Administration’s (NASA) Jet Propulsion Laboratory (JPL), California Institute of Technology, developed the ASTER GED product. Known Issues* Known issues are provided in Section 4, starting on page 8 of the User Guide.Improvements/Changes from Previous Versions* Includes data for the entire globe.* Includes the mean climatology of all ASTER data for the specific temporal extent.

restrictednotspecifiedApr 2025View details →
nasa24/100

SAGE III/ISS L2 Solar Event Species Profiles (HDF5) V006

g3bssp_6 is the Stratospheric Aerosol and Gas Experiment III (SAGE III) on the International Space Station (ISS) (SAGE III/ISS) Level 2 Solar Event Species Profiles (HDF5) V06 data product. It contains all the species products for a single solar event. SAGE III was Launched on February 19, 2017 on a SpaceX Falcon 9 from Kennedy Space Center, SAGE III-ISS is the second instrument from the SAGE III project, externally mounted on the ISS. This ISS-based instrument uses a technique known as occultation, which involves looking at the light from the Sun or Moon as it passes through Earth's atmosphere at the edge, or limb, of the planet to provide long-term monitoring of ozone vertical profiles of the stratosphere and mesosphere. The data provided by SAGE III-ISS includes key components of atmospheric composition and their long-term variability, focusing on the study of aerosols, chlorine dioxide, clouds, nitrogen dioxide, nitrogen trioxide, pressure and temperature, and water vapor. SAGE data has historically been used by the World Meteorological Organization to inform their periodic assessments of ozone depletion. These new observations from the International Space Station will continue the SAGE team's contributions to ongoing scientific understanding of the Earth's atmosphere.

restrictednotspecifiedApr 2025View details →

ScienceDex guides

Understand access before you commit

These curated guides explain access requirements, typical timelines, costs, and reuse considerations for widely used research datasets.

Compare curated datasets

Allen Brain Atlas

Allen Brain Atlas is an Allen Institute collection of brain map atlases, datasets, APIs, and analysis tools covering mouse, human, and non-human primate brain resources.

allen-brain-atlas
neuroscienceopenDocumentation, web resources, and API references are available online.
Last verified 2026-04-30Open record

Annotated Behaviour and Observability Dataset (ABODe)

ABODe is a University of Edinburgh DataShare dataset for behavior classification in group-housed mice using home-cage video, identities, bounding boxes, ground-plate positions, and annotator labels.

abode-home-cage
behavioral-neuroscienceopenThe DataShare record exposes download links for annotations, documentation, license text, and the zipped per-snippet data directory.
Last verified 2026-04-30Open record

DANDI Archive for NWB datasets

DANDI is a BRAIN Initiative archive for publishing and sharing neurophysiology data, including electrophysiology, optophysiology, and behavioral data packaged as NWB and related standards.

dandi-nwb
electrophysiologyopenPublished Dandiset metadata and archive endpoints are available through the production DANDI API.
Last verified 2026-04-30Open record

International Brain Laboratory public data

The International Brain Laboratory public data releases expose standardized mouse decision-making experiments, including Neuropixels recordings, widefield calcium imaging, behavior, and session metadata accessed through the ONE API.

ibl
behavioral-neuroscienceopenPublic sessions can be searched and loaded from the IBL public data server through ONE.
Last verified 2026-04-29Open record

OpenNeuro

OpenNeuro is a free, open platform for sharing neuroimaging datasets, with public search, dataset pages, and download paths for web, S3, DataLad, and the OpenNeuro CLI.

openneuro
neuroscienceopenPublished datasets are available on demand over the internet.
Last verified 2026-04-29Open record