Find research datasets worth reusing
Search datasets from major research repositories and use ShareScore to quickly assess how well each record supports discovery, access, and reuse.
86
datasets available to search
ShareScore release 0.9.0
Dataset results
86 results for “hdf5”
DMC sCMOS 8-bit preview of 16-bit HDF5 dataset
<p>Preview video of https://zenodo.org/record/570045. 16-bit data -> 8-bit FFV1 AVI</p> <p>Filename is a mistake, it's 2012 december 25</p> <p>Elapsed time activity (note, video is comprised of several time cuts of activity in the night)</p> <p>video has not been altered except for scaling to 8-bit with auto-contrast set every 100 frames or so.</p> <p>5:50-6:40 flaming/dispersive</p> <p>7:30-8:20 kelvin helmholtz swirls of various sizes and intensities</p> <p>9:50-10:55 kinking, folding</p> <p>11:20-14:00 kelvin helmholtz from small to huge, slow to fast, "blowing smoke" like swirls</p> <p>14:00-14:30 kelvin helmholtz swirls with flickering</p> <p>17:00-18:00 faint wisps of kelvin helmholts</p> <p>32:45-37:00 more kelvin helmholtz of various scales</p> <p>50:32- 1:21:30 Is this wispy clouds or light/faint aurora with dark patterns?</p> <p>1:33:13, 1:35:05, 1:38:40 satellite pass and 1:39:15, 1:42:33, 1:43:13, 1:45:25, 1:47:40</p>
IFC HDF5 Building Models
<p>This is a set of building models to assess the implications of a binary HDF5-based serialization for Industry Foundation Classes (IFC) building models. This serialization is based on ISO 10303-26, but includes additional profiles tailored to use cases in the building industry.</p>
Eiger HDF5 protein crystal diffraction images of TTR-Pt
<p>These data will be used during the Pasteur Course 3rd Integrative Structural Biology 2018 MX tutorials.</p> <p>The sequence of the protein is (127 amino acids, MW 13.76 kDa):</p> <p>> TTR<br> GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT<br> TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYST<br> TAVVTNPKE</p> <p> </p> <p>There are 5 main platinum sites.</p>
nSOLT first paper v1.5.2 figure data HDF5
<p>Data for the figures in the manuscript, "A reduced model of neutral-plasma interactions in the edge and scrape-off-layer: verification comparisons with kinetic Monte Carlo simulations" in HDF5 format.E</p>
HDF5 JetClass
<p>HDF5 version of JetClass. Do not use the key "Pmu_cyl". It is incorrect.</p>
3D HDF5 data from numerical relativity simulations
<p>3D HDF5 data from numerical relativity simulations. Test data for visualization purposes.</p>
ENDF/B-VIII.0 HDF5 library for OpenMC with cross sections at 20 K
<p>This archive contains a processed ENDF/B-VIII.0 HDF5 library for use with the <a href="https://github.com/openmc-dev/openmc">OpenMC</a> Monte Carlo particle transport code. Neutron cross sections are present at temperatures of 20, 294, and 600 K.</p>
alpha Synuclein PIFE HDF5 files and analyses
<p>smPIFE measurements of the alpha Synuclein monomer and of ssDNA & dsDNA - analysis documentation (Jupyter notebook) and raw data files (photon HDF5).</p>
HDF5 JetClass train4
Open the record for dataset details and reuse information.
HDF5 JetClass train3
Open the record for dataset details and reuse information.
HDF5 JetClass train2
Open the record for dataset details and reuse information.
HDF5 JetClass train1
Open the record for dataset details and reuse information.
HDF5 JetClass3
Open the record for dataset details and reuse information.
HDF5 JetClass1
Open the record for dataset details and reuse information.
HDF5 JetClass2
Open the record for dataset details and reuse information.
HDF5 JetClass4
Open the record for dataset details and reuse information.
Hdf5 input files for FICOS simulator
<p>This resource contains the hdf5 input files needed by the FICOS water quality simulator. To use them with the ficosUQ package, download the files below and place them in the ficosUQ/data folder:</p> <ul> <li>hd_files.hdf5 : Boundary conditions.</li> <li>hd_files_ma_5.hdf5 : Boundary conditions with moving average smoothing for solar radiation.</li> <li>loading.hdf5 : Nutrient loadings.</li> <li>loading_Aurajoki.hdf5 : Nutrient loadings based on the Aurajoki basin.</li> </ul>
ASTER Global Emissivity Dataset, 1 kilometer, HDF5 V003
The Terra Advanced Spaceborne Thermal Emission and Reflection Radiometer (ASTER) Global Emissivity Dataset (GED) land surface temperature and emissivity (LST&E) data products are generated using the ASTER Temperature Emissivity Separation (TES) algorithm with a Water Vapor Scaling (WVS) atmospheric correction method using Moderate Resolution Imaging Spectroradiometer (MODIS) MOD07_L2 atmospheric profiles and the MODerate Spectral resolution TRANsmittance (MODTRAN 5.2) radiative transfer model. This dataset is computed from all clear-sky pixels of ASTER scenes acquired from 2000 through 2008. The National Aeronautics and Space Administration’s (NASA) Jet Propulsion Laboratory (JPL), California Institute of Technology, developed the ASTER GED product.Known Issues* Known issues are provided in Section 4 of the User Guide.Improvements/Changes from Previous Versions* Includes data for the entire globe.* Includes the mean climatology of all ASTER data for the specific temporal extent.
ASTER Global Emissivity Dataset, 100 meter, HDF5 V003
Advanced Spaceborne Thermal Emission and Reflection Radiometer (ASTER) Global Emissivity Dataset (GED) land surface temperature and emissivity (LST&E) data products are generated using the ASTER Temperature Emissivity Separation (TES) algorithm with a Water Vapor Scaling (WVS) atmospheric correction method using Moderate Resolution Imaging Spectroradiometer (MODIS) MOD07_L2 atmospheric profiles and the MODerate spectral resolution TRANsmittance (MODTRAN 5.2 radiative transfer model). This dataset is computed from all clear-sky pixels of ASTER scenes acquired from 2000 through 2008. AG100 data are available globally at spatial resolution of 100 meters.The National Aeronautics and Space Administration’s (NASA) Jet Propulsion Laboratory (JPL), California Institute of Technology, developed the ASTER GED product. Known Issues* Known issues are provided in Section 4, starting on page 8 of the User Guide.Improvements/Changes from Previous Versions* Includes data for the entire globe.* Includes the mean climatology of all ASTER data for the specific temporal extent.
SAGE III/ISS L2 Solar Event Species Profiles (HDF5) V006
g3bssp_6 is the Stratospheric Aerosol and Gas Experiment III (SAGE III) on the International Space Station (ISS) (SAGE III/ISS) Level 2 Solar Event Species Profiles (HDF5) V06 data product. It contains all the species products for a single solar event. SAGE III was Launched on February 19, 2017 on a SpaceX Falcon 9 from Kennedy Space Center, SAGE III-ISS is the second instrument from the SAGE III project, externally mounted on the ISS. This ISS-based instrument uses a technique known as occultation, which involves looking at the light from the Sun or Moon as it passes through Earth's atmosphere at the edge, or limb, of the planet to provide long-term monitoring of ozone vertical profiles of the stratosphere and mesosphere. The data provided by SAGE III-ISS includes key components of atmospheric composition and their long-term variability, focusing on the study of aerosols, chlorine dioxide, clouds, nitrogen dioxide, nitrogen trioxide, pressure and temperature, and water vapor. SAGE data has historically been used by the World Meteorological Organization to inform their periodic assessments of ozone depletion. These new observations from the International Space Station will continue the SAGE team's contributions to ongoing scientific understanding of the Earth's atmosphere.
ScienceDex guides
Understand access before you commit
These curated guides explain access requirements, typical timelines, costs, and reuse considerations for widely used research datasets.
Allen Brain Atlas
Allen Brain Atlas is an Allen Institute collection of brain map atlases, datasets, APIs, and analysis tools covering mouse, human, and non-human primate brain resources.
Annotated Behaviour and Observability Dataset (ABODe)
ABODe is a University of Edinburgh DataShare dataset for behavior classification in group-housed mice using home-cage video, identities, bounding boxes, ground-plate positions, and annotator labels.
DANDI Archive for NWB datasets
DANDI is a BRAIN Initiative archive for publishing and sharing neurophysiology data, including electrophysiology, optophysiology, and behavioral data packaged as NWB and related standards.
International Brain Laboratory public data
The International Brain Laboratory public data releases expose standardized mouse decision-making experiments, including Neuropixels recordings, widefield calcium imaging, behavior, and session metadata accessed through the ONE API.
OpenNeuro
OpenNeuro is a free, open platform for sharing neuroimaging datasets, with public search, dataset pages, and download paths for web, S3, DataLad, and the OpenNeuro CLI.