Skip to main content
Powered by ShareScore

Find research datasets worth reusing

Search datasets from major research repositories and use ShareScore to quickly assess how well each record supports discovery, access, and reuse.

169

datasets available to search

ShareScore release 0.9.0

Reset

Dataset results

169 results for “Diffraction images”

Learn how ShareScore rates datasets ↗
zenodo36/100

Diffraction images for crystals of the Roseobacter denitrificans nitric oxide reductase (PDB code 4XYD)

<p>X-ray diffraction images corresponding to the dataset from which pdb entry 4XYD was refined.</p> <p>Data was collected at the ESRF.</p> <p>The paper describing the structure is:</p> <p>Structure of the membrane-intrinsic nitric oxide reductase from Roseobacter denitrificans</p> <p>Allister Crow, Yuji Matsuda, Hiroyuki Arata, and Arthur Oubrie</p> <p>doi 10.1021/acs.biochem.6b00332</p> <p>&nbsp;</p>

opencc-zeroAug 2015View details →
zenodo36/100

High resolution X-ray diffraction images for yeast 5-aminolevulinic acid dehydratase complexed with levulinic acid.

<p>X-ray diffraction images collected at DESY Hamburg in June 1998 using beamline BW7B. </p>

opencc-by-4.0Jan 2017View details →
zenodo36/100

X-ray diffraction images for endothiapepsin co-crystallised with inhibitor H189 to 0.94 Angstrom resolution.

<p>X-ray diffraction images collected on 23rd May 2000 at the BW7B beamline of DESY (Hamburg). </p>

opencc-by-4.0Jan 2017View details →
zenodo36/100

New leads for fragment based design of Re/Tc radiopharmaceutical agents: Raw Diffraction Images

<p>Multiple coordination possibilities of <em>fac</em>-[Re(CO)<sub>3</sub>]<sup>+</sup> to a protein, were found bound to the  Asp, Glu, Arg and His amino acid residues as well as to the C-terminal carboxylate in the vicinity of Leu and Pro and are described in the publication titled " <em>New leads for fragment based design of Re/Tc radiopharmaceutical agents</em>" written by Brink &amp; Helliwell, <em>IUCrJ</em>, 2017</p> <p>The raw diffraction images for the DLS and Cu Kalpha data sets are made available at the Zenodo research data archive, as specified in the publication.</p>

opencc-by-4.0Mar 2017View details →
zenodo36/100

Electron backscatter diffraction data and backscatter electron images from a cold-rolled and recovered Al-Mn alloy

<p>Three electron backscatter diffraction (EBSD) data sets and three sets of backscatter electron (BSE) images from the same region of interest in a cold-rolled and recovered Al-Mn alloy.</p> <p>The data forms part of the supplementary material to the paper H W &Aring;nes, A T J van Helvoort, K Marthinsen &quot;Correlated subgrain and particle analysis of a recovered Al-Mn alloy by directly combining EBSD and backscatter electron imaging&quot; (2022), published in Materials Characterization.</p> <p>The data was acquired in order to study the effect of particles on recovery and recrystallization in the Al-Mn alloy. The particles detected in the BSE images were inserted in the EBSD map after the EBSD map had been corrected for distortions by image registration using the BSE images.</p> <p>See the GitHub repository https://github.com/hakonanes/correlated-grains-particles-workflow for Jupyter notebooks and (MATLAB) MTEX scripts used to analyze the data.</p>

opencc-by-4.0May 2022View details →
zenodo36/100

Electron diffraction image files of rhodamine-6g microcrystals with CRYO ARM 300

<p>Diffraction images of rhodamine-6g collected with JEOL CRYO ARM 300 electron microscope at RIKEN, SPring-8. High-tension voltage was 300 kV. Camera distance was nominally 800 mm, but it could be calibrated with power-diffraction pattern of a gold sputtered grid. They were recorded with DirectElectron DE64 detector. Diffractions for orthorhombic crystals were collected at R.T. and cryo conditions and those for triclinic crystals were at cryo condition. Images were x2 binned and used for processing with DIALS. The output hkl files are also included in this entry.</p>

opencc-by-4.0Jun 2022View details →
zenodo36/100

SC-XRD diffraction images of stereo-defined pyrrolidine ligand

<p>Structures of a piperazine in the publication: "Direct and Stereospecific [3+2] Synthesis of Pyrrolidines from Simple Unactivated Alkenes" Angew. Chem. Int. Ed. 2017, DOI:10.1002/anie.201706682</p> <p>Structure solutions were deposited in the CCDC: 1528080<br> https://www.ccdc.cam.ac.uk/structures-beta/Search?id=doi:10.1002/anie.201706682</p>

opencc-by-4.0Aug 2017View details →
zenodo36/100

Eiger HDF5 protein crystal diffraction images of TTR-Pt

<p>These data will be used during the&nbsp;Pasteur Course 3rd Integrative Structural Biology 2018 MX tutorials.</p> <p>The sequence of the protein is (127 amino acids, MW 13.76 kDa):</p> <p>&gt; TTR<br> GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT<br> TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYST<br> TAVVTNPKE</p> <p>&nbsp;</p> <p>There are 5 main platinum sites.</p>

opencc-by-sa-4.0Jul 2018View details →
zenodo36/100

Diffraction images of a crystal of a SH3 domain

<p>Data were collected on a single crystal at the beamline i03 of the Diamond synchrotron facility (Didcot, UK) using radiation of 0.99998&nbsp;&Aring; wavelength and a PILATUS3 6M detector. The dataset consists of 3600 images (0.1 degree oscillation per image). Data extend to ~1.1 &Aring; resolution.</p>

opencc-by-sa-4.0Dec 2017View details →
zenodo36/100

Raw diffraction images of SmgGDS-558 and farnesylated RhoA complex

<p>Diffraction images of SmgGDS-558 and farnesylated RhoA complex (PDB code: 5ZHX).<br> <br> Small and large wedge (1, 5, 180, 360, .. degrees per crystal) datasets&nbsp;were collected from beamlines BL41XU and BL44XU at SPring-8 and BL1A&nbsp;at Photon Factory.&nbsp;PILATUS3 6M (BL41XU), MX300-HS (BL44XU), and EIGER X 4M (BL1A) detectors were used at wavelengths of 0.9 and 1.0 &Aring;.</p> <p>The crystals belonged to space group P2<sub>1</sub>2<sub>1</sub>2<sub>1</sub> with unit cell parameters&nbsp;a=93.3, b=181.8, c=205.3 &Aring;.<br> <br> Electron density maps from various combinations of datasets were&nbsp;evaluated through KAMO, and finally data from 20161010_BL44XU/kozo0001 were merged and used for structural refinement at 3.5 &Aring; resolution.<br> <br> Note that the master.h5 files were modified; see<br> <a href="https://github.com/keitaroyam/yamtbx/blob/master/doc/eiger-en.md">https://github.com/keitaroyam/yamtbx/blob/master/doc/eiger-en.md</a></p>

opencc-by-4.0Sep 2018View details →
zenodo36/100

Raw diffraction images of Chrimson

<p>Chrimson is a red-shifted channelrhodopsin from the algae&nbsp;<em>Chlamydomonas noctigama</em>. The crystals were obtained within the&nbsp;lipidic cubic phase (LCP).<br> <br> 45 small-wedge (10 or 20&deg;/crystal) and 8 helical (50-100&deg;/crystal)&nbsp;datasets collected from loop-harvested microcrystals using EIGER X 9M&nbsp;detector at a wavelength of 1 &Aring; on BL32XU, SPring-8. The crystals&nbsp;belonged to space group P2<sub>1</sub>2<sub>1</sub>2<sub>1</sub> with unit cell parameters a=61.0,&nbsp;b=81.4, c=170.1 &Aring;. 13 datasets were merged at 2.6 &Aring; resolution in the&nbsp;published result (Nature Comm., 2018; PDB code: 5ZIH) using KAMO; see processing&nbsp;note&nbsp;<a href="https://github.com/keitaroyam/yamtbx/wiki/Processing-Chrimson-data-(5ZIH)">https://github.com/keitaroyam/yamtbx/wiki/Processing-Chrimson-data-(5ZIH)</a></p>

opencc-by-4.0Sep 2018View details →
zenodo36/100

Raw diffraction images of cypovirus polyhedra crystals containing Pd(allyl) complexes

<p>Diffraction images of wild type cypovirus polyhedra in-vivo crystals (WTPhC) and the mutant (&Delta;3-PhC) related to PDB codes <a href="https://www.rcsb.org/structure/5YHA">5YHA</a> and <a href="https://www.rcsb.org/structure/5YHB">5YHB</a>, respectively (<a href="http://dx.doi.org/10.1039/c7cp06651a">Abe et al., 2017, Phys. Chem. Chem. Phys.</a>).</p> <p>Small-wedge (5&deg; or 10&deg;/crystal) datasets were collected from loop-harvested microcrystals automatically with ZOO system using EIGER X 9M detector at a wavelength of 1 &Aring; on BL32XU, SPring-8.</p> <p>The crystals belonged to space group I23 with unit cell parameter a~103 &Aring;. All datasets were processed and merged using KAMO pipeline with XDS.</p> <p>NOTE that master.h5 files were modified; see <a href="https://github.com/keitaroyam/yamtbx/blob/master/doc/eiger-en.md">https://github.com/keitaroyam/yamtbx/blob/master/doc/eiger-en.md</a>.</p>

opencc-by-4.0Jan 2018View details →
zenodo36/100

Raw diffraction images of cross-linked cypovirus polyhedra mutant crystals

<p>Diffraction images of cross-linked cypovirus polyhedra mutant crystals related to PDB codes <a href="https://www.rcsb.org/structure/5YR1">5YR1</a>, <a href="https://www.rcsb.org/structure/5YR9">5YR9</a>, <a href="https://www.rcsb.org/structure/5YRA">5YRA</a>, <a href="https://www.rcsb.org/structure/5YRB">5YRB</a>, <a href="https://www.rcsb.org/structure/5YRC">5YRC</a>, and <a href="https://www.rcsb.org/structure/5YRD">5YRD</a> (<a href="http://dx.doi.org/10.1039/c7cc08689j">Negishi et al. 2018, Chem. Commun.</a>).</p> <p>Small-wedge (5&deg; or 10&deg;/crystal) datasets were collected from loop-harvested microcrystals at a wavelength of 1 &Aring; on BL32XU and BL41XU, SPring-8. The datasets for 5YR1, 5YR9, 5YRB, and 5YRC were collected automatically using ZOO system.</p> <p>The crystals belonged to space group I23 with unit cell parameter a~103 &Aring;. All datasets were processed and merged using KAMO pipeline with XDS.</p> <p>This entry includes following data:</p> <ul> <li> <p>1-PhC (5YR1, 1.72 &Aring;)</p> <ul> <li> <p>BL32XU (EIGER X 9M)</p> </li> <li> <p>5&deg;/crystal &times;32 (0.1&deg;/frame)</p> </li> </ul> </li> <li> <p>2-PhC (5YR9, 1.70 &Aring;)</p> <ul> <li> <p>BL32XU (MX-225HS)</p> </li> <li> <p>5&deg;/crystal &times; 127 (1&deg;/frame)</p> </li> </ul> </li> <li> <p>3-PhC (5YRA, 1.79 &Aring;)</p> <ul> <li> <p>BL41XU (PILATUS3 6M)</p> </li> <li> <p>5&deg; or 10&deg;/crystal &times; 49 (0.25&deg;/frame)</p> </li> </ul> </li> <li> <p>ox1-PhC (5YRB, 1.65 &Aring;)</p> <ul> <li> <p>BL32XU (EIGER X 9M)</p> </li> <li> <p>5&deg;/crystal &times; 78 (0.1&deg;/frame)</p> </li> </ul> </li> <li> <p>ox2-PhC (5YRC, 1.67 &Aring;)</p> <ul> <li> <p>BL32XU (MX-225HS)</p> </li> <li> <p>5&deg;/crystal &times; 323 (1&deg;/frame)</p> </li> </ul> </li> <li> <p>ox3-PhC (5YRD, 1.85 &Aring;)</p> <ul> <li> <p>BL41XU (PILATUS3 6M)</p> </li> <li> <p>5&deg;/crystal &times; 29 (0.25&deg;/frame)</p> </li> </ul> </li> </ul> <p>NOTE that EIGER&#39;s master.h5 files were modified; see <a href="https://github.com/keitaroyam/yamtbx/blob/master/doc/eiger-en.md">https://github.com/keitaroyam/yamtbx/blob/master/doc/eiger-en.md</a>.</p>

opencc-by-4.0Feb 2018View details →
zenodo36/100

Raw diffraction images of human muscarinic acetylcholine receptor

<p>Raw data for&nbsp;<a href="https://www.rcsb.org/structure/5ZK8">5ZK8</a>&nbsp;(M<sub>2</sub>-BRIL&ndash;NMS),&nbsp;<a href="https://www.rcsb.org/structure/5ZKC">5ZKC</a>&nbsp;(S110R-BRIL&ndash;NMS),&nbsp;<a href="https://www.rcsb.org/structure/5ZKB">5ZKB</a>(S110R-BRIL&ndash;AF-DX 384), and&nbsp;<a href="https://www.rcsb.org/structure/5ZK3">5ZK3</a>&nbsp;(S110R-BRIL&ndash;QNB).&nbsp;</p>

opencc-by-4.0Nov 2018View details →
zenodo36/100

Raw diffraction images of plant vacuolar iron transporter VIT1 (with Zn and Co)

<p>Diffraction images of full-length VIT1 related to PDB codes <a href="https://www.rcsb.org/structure/6IU3">6IU3</a>&nbsp;(Zn-bound) and <a href="https://www.rcsb.org/structure/6IU4">6IU4</a> (Co-bound). All data were collected from&nbsp;loop-harvested (micro)crystals on BL32XU, SPring-8 using EIGER X 9M detector.<br> <br> 6IU3: Helical (20, 45, or 90&deg;/crystal) datasets were collected&nbsp;automatically using ZOO system at a wavelength of 1 &Aring;.<br> 6IU4: Small-wedge (10&deg;/crystal) and helical (120&deg;/crystal) datasets were collected at a wavelength of 1.28 &Aring;.<br> <br> The crystals belonged to space group <em>C</em>222<sub>1</sub> with unit cell parameter&nbsp;a~47, b~290, c~46 &Aring;. All datasets were processed and merged using KAMO&nbsp;pipeline with XDS.</p> <p>Related entries:&nbsp;<a href="https://zenodo.org/record/2532134">metal binding domain</a>, <a href="https://zenodo.org/record/2532138">data for phasing&nbsp;by Hg-SIR</a>&nbsp;<br> &nbsp;</p>

opencc-by-4.0Feb 2019View details →
zenodo36/100

Raw diffraction images of plant vacuolar iron transporter VIT1 (metal binding domain)

<p>Diffraction images of the metal binding domain of&nbsp;VIT1&nbsp;related to PDB&nbsp;codes <a href="http://www.rcsb.org/structure/6IU5">6IU5</a> (Zn-bound), <a href="http://www.rcsb.org/structure/6IU6">6IU6</a> (Ni-bound), <a href="http://www.rcsb.org/structure/6IU8">6IU8</a> (Co-bound), and <a href="http://www.rcsb.org/structure/6IU9">6IU9</a>&nbsp;(Fe-bound).</p> <p>Helical data (180&deg;/crystal) were collected from&nbsp;loop-harvested crystals on BL41XU, SPring-8 at the peak and low-remote&nbsp;wavelengths of specific metals (Zn: 1.2820/1.3000; Ni: 1.4850/1.5220;&nbsp;Co: 1.6050/1.6480; Fe: 1.74009/1.79148 &Aring;).</p> <p>The crystals belonged to space group <em>P</em>3<sub>1</sub> with unit cell parameter a~85, c~98 &Aring;.</p> <p>Related entries:&nbsp;<a href="https://zenodo.org/record/2532136">full-length with Co/Zn</a>, <a href="https://zenodo.org/record/2532138">full-length data for phasing&nbsp;by Hg-SIR</a></p>

opencc-by-4.0Feb 2019View details →
zenodo36/100

Raw diffraction images of plant vacuolar iron transporter VIT1 (phasing data by Hg-SIR)

<p>Diffraction images of full-length VIT1 for Hg-SIR phasing. All data&nbsp;were collected from loop-harvested crystals on BL32XU, SPring-8 at a&nbsp;wavelength of 1 &Aring; using the EIGER X 9M detector.</p> <p>For Hg-bound VIT1, six helical (71-210&deg;/crystal) datasets were&nbsp;collected. From native (without Hg) crystals, 24 helical&nbsp;(20-90&deg;/crystal) datasets were automatically collected.&nbsp;The crystals belonged to space group <em>C</em>222<sub>1</sub> with unit cell parameter a~47, b~290, c~46 &Aring;.</p> <p>Related entries:&nbsp;<a href="https://zenodo.org/record/2532136">full-length with Co/Zn</a>,&nbsp;<a href="https://zenodo.org/record/2532134">metal binding domain</a><br> &nbsp;</p>

opencc-by-4.0Feb 2019View details →
zenodo36/100

Raw diffraction images of Ferroportin homologue (phasing data by Hg-SIRAS)

<p>Diffraction images of native and&nbsp;mercury-bound Ferroportin&nbsp;homologue from&nbsp;Bdellovibrio bacteriovorus. This phase information was used for PDB entries&nbsp;<a href="http://www.pdb.org/pdb/search/structidSearch.do?structureId=5AYM">5AYM</a>&nbsp;and&nbsp;<a href="http://www.pdb.org/pdb/search/structidSearch.do?structureId=5AYN">5AYN</a>, and indirectly&nbsp;<a href="http://www.pdb.org/pdb/search/structidSearch.do?structureId=5AYO">5AYO</a>&nbsp;(<a href="https://doi.org/10.1038/ncomms9545">Taniguchi et al. 2015</a>). All data&nbsp;were collected from loop-harvested crystals on BL32XU, SPring-8 at a wavelength of&nbsp;1.00000 &Aring; using the MX225HS&nbsp;CCD detector.</p> <p>From a native crystal, a helical (180&deg;/crystal, 1&deg;/frame) datasets were&nbsp;collected using 12&times;8&nbsp;&mu;m<sup>2</sup> beam.&nbsp;From a mercury-derivative crystals,&nbsp;two helical&nbsp;(180&deg;/crystal, 1.5&deg;/frame) datasets were collected using 10&times;2&nbsp;&mu;m<sup>2</sup> beam.&nbsp;The crystals belonged to space group&nbsp;<em>P</em>2<sub>1</sub>2<sub>1</sub>2<sub>1</sub>&nbsp;with unit cell parameter a~57, b~86,&nbsp;c~96 &Aring;.</p>

opencc-by-4.0Oct 2015View details →
zenodo36/100

Raw diffraction images of YidC (phasing data by Hg-MAD)

<p>Diffraction images of mercury-bound&nbsp;<em>Bacillus halodurans</em>&nbsp;YidC mutants for Hg-MAD&nbsp;phasing. This phase information was used for PDB entries&nbsp;<a href="http://www.pdb.org/pdb/search/structidSearch.do?structureId=3WO6">3WO6</a>&nbsp;and&nbsp;<a href="http://www.pdb.org/pdb/search/structidSearch.do?structureId=3WO7">3WO7</a>&nbsp;(<a href="https://doi.org/10.1038/nature13167">Kumazaki et al. 2014</a>).&nbsp;All data&nbsp;were collected from loop-harvested crystals on BL32XU, SPring-8 at wavelengths of&nbsp;1.00000 &Aring; (peak) or&nbsp;1.00945 &Aring; (edge)&nbsp;using the MX225HE&nbsp;CCD detector.</p> <p>From the M146C mutant,&nbsp;helical (360 or 720&deg;/crystal, 2&deg;/frame) datasets were&nbsp;collected using 10&times;1 &mu;m<sup>2</sup> beam.&nbsp;From a Y150C mutant, a helical&nbsp;(360&deg;/crystal, 2.5&deg;/frame) dataset was collected using 15&times;1 &mu;m<sup>2</sup> beam, which was used for phase determination.&nbsp;The crystals belonged to space group&nbsp;<em>P</em>2<sub>1</sub>&nbsp;with unit cell parameter a~44, b~60, c~60 &Aring;, &beta;~100&deg;.</p>

opencc-by-4.0Apr 2014View details →
zenodo36/100

Raw diffraction images of H+/Ca2+ exchanger CAX (phasing data by Hg-MAD)

<p>Diffraction images of mercury-bound H<sup>+</sup>/Ca<sup>2+</sup> exchanger from <em>Archaeoglobus fulgidus</em>. This phase information was used for a PDB entry&nbsp;<a href="https://www.rcsb.org/structure/4KPP">4KPP</a>&nbsp;(<a href="http://science.sciencemag.org/content/341/6142/168">Nishizawa et al. 2013</a>). All data&nbsp;were collected from loop-harvested crystals on BL32XU, SPring-8 at wavelengths of&nbsp;1.00000 &Aring; (peak),&nbsp;1.00930 &Aring;&nbsp;(edge), or 1.01300 &Aring; (low remote) using the MX225HE&nbsp;CCD detector.</p> <p>From a mercury-derivatised&nbsp;crystal, helical (360&deg;/crystal, 1&deg;/frame)&nbsp;datasets were&nbsp;collected using 5&times;1 &mu;m<sup>2</sup> beam. The crystal belonged to space group&nbsp;<em>P</em>2<sub>1</sub>&nbsp;with unit cell parameter a~64, b~98,&nbsp;c~72 &Aring;, &beta;~99&deg;.</p>

opencc-by-4.0Jul 2013View details →

ScienceDex guides

Understand access before you commit

These curated guides explain access requirements, typical timelines, costs, and reuse considerations for widely used research datasets.

Compare curated datasets

Allen Brain Atlas

Allen Brain Atlas is an Allen Institute collection of brain map atlases, datasets, APIs, and analysis tools covering mouse, human, and non-human primate brain resources.

allen-brain-atlas
neuroscienceopenDocumentation, web resources, and API references are available online.
Last verified 2026-04-30Open record

Annotated Behaviour and Observability Dataset (ABODe)

ABODe is a University of Edinburgh DataShare dataset for behavior classification in group-housed mice using home-cage video, identities, bounding boxes, ground-plate positions, and annotator labels.

abode-home-cage
behavioral-neuroscienceopenThe DataShare record exposes download links for annotations, documentation, license text, and the zipped per-snippet data directory.
Last verified 2026-04-30Open record

DANDI Archive for NWB datasets

DANDI is a BRAIN Initiative archive for publishing and sharing neurophysiology data, including electrophysiology, optophysiology, and behavioral data packaged as NWB and related standards.

dandi-nwb
electrophysiologyopenPublished Dandiset metadata and archive endpoints are available through the production DANDI API.
Last verified 2026-04-30Open record

International Brain Laboratory public data

The International Brain Laboratory public data releases expose standardized mouse decision-making experiments, including Neuropixels recordings, widefield calcium imaging, behavior, and session metadata accessed through the ONE API.

ibl
behavioral-neuroscienceopenPublic sessions can be searched and loaded from the IBL public data server through ONE.
Last verified 2026-04-29Open record

OpenNeuro

OpenNeuro is a free, open platform for sharing neuroimaging datasets, with public search, dataset pages, and download paths for web, S3, DataLad, and the OpenNeuro CLI.

openneuro
neuroscienceopenPublished datasets are available on demand over the internet.
Last verified 2026-04-29Open record