Find research datasets worth reusing
Search datasets from major research repositories and use ShareScore to quickly assess how well each record supports discovery, access, and reuse.
169
datasets available to search
ShareScore release 0.9.0
Dataset results
169 results for “Diffraction images”
Diffraction images for crystals of the Roseobacter denitrificans nitric oxide reductase (PDB code 4XYD)
<p>X-ray diffraction images corresponding to the dataset from which pdb entry 4XYD was refined.</p> <p>Data was collected at the ESRF.</p> <p>The paper describing the structure is:</p> <p>Structure of the membrane-intrinsic nitric oxide reductase from Roseobacter denitrificans</p> <p>Allister Crow, Yuji Matsuda, Hiroyuki Arata, and Arthur Oubrie</p> <p>doi 10.1021/acs.biochem.6b00332</p> <p> </p>
High resolution X-ray diffraction images for yeast 5-aminolevulinic acid dehydratase complexed with levulinic acid.
<p>X-ray diffraction images collected at DESY Hamburg in June 1998 using beamline BW7B. </p>
X-ray diffraction images for endothiapepsin co-crystallised with inhibitor H189 to 0.94 Angstrom resolution.
<p>X-ray diffraction images collected on 23rd May 2000 at the BW7B beamline of DESY (Hamburg). </p>
New leads for fragment based design of Re/Tc radiopharmaceutical agents: Raw Diffraction Images
<p>Multiple coordination possibilities of <em>fac</em>-[Re(CO)<sub>3</sub>]<sup>+</sup> to a protein, were found bound to the Asp, Glu, Arg and His amino acid residues as well as to the C-terminal carboxylate in the vicinity of Leu and Pro and are described in the publication titled " <em>New leads for fragment based design of Re/Tc radiopharmaceutical agents</em>" written by Brink & Helliwell, <em>IUCrJ</em>, 2017</p> <p>The raw diffraction images for the DLS and Cu Kalpha data sets are made available at the Zenodo research data archive, as specified in the publication.</p>
Electron backscatter diffraction data and backscatter electron images from a cold-rolled and recovered Al-Mn alloy
<p>Three electron backscatter diffraction (EBSD) data sets and three sets of backscatter electron (BSE) images from the same region of interest in a cold-rolled and recovered Al-Mn alloy.</p> <p>The data forms part of the supplementary material to the paper H W Ånes, A T J van Helvoort, K Marthinsen "Correlated subgrain and particle analysis of a recovered Al-Mn alloy by directly combining EBSD and backscatter electron imaging" (2022), published in Materials Characterization.</p> <p>The data was acquired in order to study the effect of particles on recovery and recrystallization in the Al-Mn alloy. The particles detected in the BSE images were inserted in the EBSD map after the EBSD map had been corrected for distortions by image registration using the BSE images.</p> <p>See the GitHub repository https://github.com/hakonanes/correlated-grains-particles-workflow for Jupyter notebooks and (MATLAB) MTEX scripts used to analyze the data.</p>
Electron diffraction image files of rhodamine-6g microcrystals with CRYO ARM 300
<p>Diffraction images of rhodamine-6g collected with JEOL CRYO ARM 300 electron microscope at RIKEN, SPring-8. High-tension voltage was 300 kV. Camera distance was nominally 800 mm, but it could be calibrated with power-diffraction pattern of a gold sputtered grid. They were recorded with DirectElectron DE64 detector. Diffractions for orthorhombic crystals were collected at R.T. and cryo conditions and those for triclinic crystals were at cryo condition. Images were x2 binned and used for processing with DIALS. The output hkl files are also included in this entry.</p>
SC-XRD diffraction images of stereo-defined pyrrolidine ligand
<p>Structures of a piperazine in the publication: "Direct and Stereospecific [3+2] Synthesis of Pyrrolidines from Simple Unactivated Alkenes" Angew. Chem. Int. Ed. 2017, DOI:10.1002/anie.201706682</p> <p>Structure solutions were deposited in the CCDC: 1528080<br> https://www.ccdc.cam.ac.uk/structures-beta/Search?id=doi:10.1002/anie.201706682</p>
Eiger HDF5 protein crystal diffraction images of TTR-Pt
<p>These data will be used during the Pasteur Course 3rd Integrative Structural Biology 2018 MX tutorials.</p> <p>The sequence of the protein is (127 amino acids, MW 13.76 kDa):</p> <p>> TTR<br> GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT<br> TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYST<br> TAVVTNPKE</p> <p> </p> <p>There are 5 main platinum sites.</p>
Diffraction images of a crystal of a SH3 domain
<p>Data were collected on a single crystal at the beamline i03 of the Diamond synchrotron facility (Didcot, UK) using radiation of 0.99998 Å wavelength and a PILATUS3 6M detector. The dataset consists of 3600 images (0.1 degree oscillation per image). Data extend to ~1.1 Å resolution.</p>
Raw diffraction images of SmgGDS-558 and farnesylated RhoA complex
<p>Diffraction images of SmgGDS-558 and farnesylated RhoA complex (PDB code: 5ZHX).<br> <br> Small and large wedge (1, 5, 180, 360, .. degrees per crystal) datasets were collected from beamlines BL41XU and BL44XU at SPring-8 and BL1A at Photon Factory. PILATUS3 6M (BL41XU), MX300-HS (BL44XU), and EIGER X 4M (BL1A) detectors were used at wavelengths of 0.9 and 1.0 Å.</p> <p>The crystals belonged to space group P2<sub>1</sub>2<sub>1</sub>2<sub>1</sub> with unit cell parameters a=93.3, b=181.8, c=205.3 Å.<br> <br> Electron density maps from various combinations of datasets were evaluated through KAMO, and finally data from 20161010_BL44XU/kozo0001 were merged and used for structural refinement at 3.5 Å resolution.<br> <br> Note that the master.h5 files were modified; see<br> <a href="https://github.com/keitaroyam/yamtbx/blob/master/doc/eiger-en.md">https://github.com/keitaroyam/yamtbx/blob/master/doc/eiger-en.md</a></p>
Raw diffraction images of Chrimson
<p>Chrimson is a red-shifted channelrhodopsin from the algae <em>Chlamydomonas noctigama</em>. The crystals were obtained within the lipidic cubic phase (LCP).<br> <br> 45 small-wedge (10 or 20°/crystal) and 8 helical (50-100°/crystal) datasets collected from loop-harvested microcrystals using EIGER X 9M detector at a wavelength of 1 Å on BL32XU, SPring-8. The crystals belonged to space group P2<sub>1</sub>2<sub>1</sub>2<sub>1</sub> with unit cell parameters a=61.0, b=81.4, c=170.1 Å. 13 datasets were merged at 2.6 Å resolution in the published result (Nature Comm., 2018; PDB code: 5ZIH) using KAMO; see processing note <a href="https://github.com/keitaroyam/yamtbx/wiki/Processing-Chrimson-data-(5ZIH)">https://github.com/keitaroyam/yamtbx/wiki/Processing-Chrimson-data-(5ZIH)</a></p>
Raw diffraction images of cypovirus polyhedra crystals containing Pd(allyl) complexes
<p>Diffraction images of wild type cypovirus polyhedra in-vivo crystals (WTPhC) and the mutant (Δ3-PhC) related to PDB codes <a href="https://www.rcsb.org/structure/5YHA">5YHA</a> and <a href="https://www.rcsb.org/structure/5YHB">5YHB</a>, respectively (<a href="http://dx.doi.org/10.1039/c7cp06651a">Abe et al., 2017, Phys. Chem. Chem. Phys.</a>).</p> <p>Small-wedge (5° or 10°/crystal) datasets were collected from loop-harvested microcrystals automatically with ZOO system using EIGER X 9M detector at a wavelength of 1 Å on BL32XU, SPring-8.</p> <p>The crystals belonged to space group I23 with unit cell parameter a~103 Å. All datasets were processed and merged using KAMO pipeline with XDS.</p> <p>NOTE that master.h5 files were modified; see <a href="https://github.com/keitaroyam/yamtbx/blob/master/doc/eiger-en.md">https://github.com/keitaroyam/yamtbx/blob/master/doc/eiger-en.md</a>.</p>
Raw diffraction images of cross-linked cypovirus polyhedra mutant crystals
<p>Diffraction images of cross-linked cypovirus polyhedra mutant crystals related to PDB codes <a href="https://www.rcsb.org/structure/5YR1">5YR1</a>, <a href="https://www.rcsb.org/structure/5YR9">5YR9</a>, <a href="https://www.rcsb.org/structure/5YRA">5YRA</a>, <a href="https://www.rcsb.org/structure/5YRB">5YRB</a>, <a href="https://www.rcsb.org/structure/5YRC">5YRC</a>, and <a href="https://www.rcsb.org/structure/5YRD">5YRD</a> (<a href="http://dx.doi.org/10.1039/c7cc08689j">Negishi et al. 2018, Chem. Commun.</a>).</p> <p>Small-wedge (5° or 10°/crystal) datasets were collected from loop-harvested microcrystals at a wavelength of 1 Å on BL32XU and BL41XU, SPring-8. The datasets for 5YR1, 5YR9, 5YRB, and 5YRC were collected automatically using ZOO system.</p> <p>The crystals belonged to space group I23 with unit cell parameter a~103 Å. All datasets were processed and merged using KAMO pipeline with XDS.</p> <p>This entry includes following data:</p> <ul> <li> <p>1-PhC (5YR1, 1.72 Å)</p> <ul> <li> <p>BL32XU (EIGER X 9M)</p> </li> <li> <p>5°/crystal ×32 (0.1°/frame)</p> </li> </ul> </li> <li> <p>2-PhC (5YR9, 1.70 Å)</p> <ul> <li> <p>BL32XU (MX-225HS)</p> </li> <li> <p>5°/crystal × 127 (1°/frame)</p> </li> </ul> </li> <li> <p>3-PhC (5YRA, 1.79 Å)</p> <ul> <li> <p>BL41XU (PILATUS3 6M)</p> </li> <li> <p>5° or 10°/crystal × 49 (0.25°/frame)</p> </li> </ul> </li> <li> <p>ox1-PhC (5YRB, 1.65 Å)</p> <ul> <li> <p>BL32XU (EIGER X 9M)</p> </li> <li> <p>5°/crystal × 78 (0.1°/frame)</p> </li> </ul> </li> <li> <p>ox2-PhC (5YRC, 1.67 Å)</p> <ul> <li> <p>BL32XU (MX-225HS)</p> </li> <li> <p>5°/crystal × 323 (1°/frame)</p> </li> </ul> </li> <li> <p>ox3-PhC (5YRD, 1.85 Å)</p> <ul> <li> <p>BL41XU (PILATUS3 6M)</p> </li> <li> <p>5°/crystal × 29 (0.25°/frame)</p> </li> </ul> </li> </ul> <p>NOTE that EIGER's master.h5 files were modified; see <a href="https://github.com/keitaroyam/yamtbx/blob/master/doc/eiger-en.md">https://github.com/keitaroyam/yamtbx/blob/master/doc/eiger-en.md</a>.</p>
Raw diffraction images of human muscarinic acetylcholine receptor
<p>Raw data for <a href="https://www.rcsb.org/structure/5ZK8">5ZK8</a> (M<sub>2</sub>-BRIL–NMS), <a href="https://www.rcsb.org/structure/5ZKC">5ZKC</a> (S110R-BRIL–NMS), <a href="https://www.rcsb.org/structure/5ZKB">5ZKB</a>(S110R-BRIL–AF-DX 384), and <a href="https://www.rcsb.org/structure/5ZK3">5ZK3</a> (S110R-BRIL–QNB). </p>
Raw diffraction images of plant vacuolar iron transporter VIT1 (with Zn and Co)
<p>Diffraction images of full-length VIT1 related to PDB codes <a href="https://www.rcsb.org/structure/6IU3">6IU3</a> (Zn-bound) and <a href="https://www.rcsb.org/structure/6IU4">6IU4</a> (Co-bound). All data were collected from loop-harvested (micro)crystals on BL32XU, SPring-8 using EIGER X 9M detector.<br> <br> 6IU3: Helical (20, 45, or 90°/crystal) datasets were collected automatically using ZOO system at a wavelength of 1 Å.<br> 6IU4: Small-wedge (10°/crystal) and helical (120°/crystal) datasets were collected at a wavelength of 1.28 Å.<br> <br> The crystals belonged to space group <em>C</em>222<sub>1</sub> with unit cell parameter a~47, b~290, c~46 Å. All datasets were processed and merged using KAMO pipeline with XDS.</p> <p>Related entries: <a href="https://zenodo.org/record/2532134">metal binding domain</a>, <a href="https://zenodo.org/record/2532138">data for phasing by Hg-SIR</a> <br> </p>
Raw diffraction images of plant vacuolar iron transporter VIT1 (metal binding domain)
<p>Diffraction images of the metal binding domain of VIT1 related to PDB codes <a href="http://www.rcsb.org/structure/6IU5">6IU5</a> (Zn-bound), <a href="http://www.rcsb.org/structure/6IU6">6IU6</a> (Ni-bound), <a href="http://www.rcsb.org/structure/6IU8">6IU8</a> (Co-bound), and <a href="http://www.rcsb.org/structure/6IU9">6IU9</a> (Fe-bound).</p> <p>Helical data (180°/crystal) were collected from loop-harvested crystals on BL41XU, SPring-8 at the peak and low-remote wavelengths of specific metals (Zn: 1.2820/1.3000; Ni: 1.4850/1.5220; Co: 1.6050/1.6480; Fe: 1.74009/1.79148 Å).</p> <p>The crystals belonged to space group <em>P</em>3<sub>1</sub> with unit cell parameter a~85, c~98 Å.</p> <p>Related entries: <a href="https://zenodo.org/record/2532136">full-length with Co/Zn</a>, <a href="https://zenodo.org/record/2532138">full-length data for phasing by Hg-SIR</a></p>
Raw diffraction images of plant vacuolar iron transporter VIT1 (phasing data by Hg-SIR)
<p>Diffraction images of full-length VIT1 for Hg-SIR phasing. All data were collected from loop-harvested crystals on BL32XU, SPring-8 at a wavelength of 1 Å using the EIGER X 9M detector.</p> <p>For Hg-bound VIT1, six helical (71-210°/crystal) datasets were collected. From native (without Hg) crystals, 24 helical (20-90°/crystal) datasets were automatically collected. The crystals belonged to space group <em>C</em>222<sub>1</sub> with unit cell parameter a~47, b~290, c~46 Å.</p> <p>Related entries: <a href="https://zenodo.org/record/2532136">full-length with Co/Zn</a>, <a href="https://zenodo.org/record/2532134">metal binding domain</a><br> </p>
Raw diffraction images of Ferroportin homologue (phasing data by Hg-SIRAS)
<p>Diffraction images of native and mercury-bound Ferroportin homologue from Bdellovibrio bacteriovorus. This phase information was used for PDB entries <a href="http://www.pdb.org/pdb/search/structidSearch.do?structureId=5AYM">5AYM</a> and <a href="http://www.pdb.org/pdb/search/structidSearch.do?structureId=5AYN">5AYN</a>, and indirectly <a href="http://www.pdb.org/pdb/search/structidSearch.do?structureId=5AYO">5AYO</a> (<a href="https://doi.org/10.1038/ncomms9545">Taniguchi et al. 2015</a>). All data were collected from loop-harvested crystals on BL32XU, SPring-8 at a wavelength of 1.00000 Å using the MX225HS CCD detector.</p> <p>From a native crystal, a helical (180°/crystal, 1°/frame) datasets were collected using 12×8 μm<sup>2</sup> beam. From a mercury-derivative crystals, two helical (180°/crystal, 1.5°/frame) datasets were collected using 10×2 μm<sup>2</sup> beam. The crystals belonged to space group <em>P</em>2<sub>1</sub>2<sub>1</sub>2<sub>1</sub> with unit cell parameter a~57, b~86, c~96 Å.</p>
Raw diffraction images of YidC (phasing data by Hg-MAD)
<p>Diffraction images of mercury-bound <em>Bacillus halodurans</em> YidC mutants for Hg-MAD phasing. This phase information was used for PDB entries <a href="http://www.pdb.org/pdb/search/structidSearch.do?structureId=3WO6">3WO6</a> and <a href="http://www.pdb.org/pdb/search/structidSearch.do?structureId=3WO7">3WO7</a> (<a href="https://doi.org/10.1038/nature13167">Kumazaki et al. 2014</a>). All data were collected from loop-harvested crystals on BL32XU, SPring-8 at wavelengths of 1.00000 Å (peak) or 1.00945 Å (edge) using the MX225HE CCD detector.</p> <p>From the M146C mutant, helical (360 or 720°/crystal, 2°/frame) datasets were collected using 10×1 μm<sup>2</sup> beam. From a Y150C mutant, a helical (360°/crystal, 2.5°/frame) dataset was collected using 15×1 μm<sup>2</sup> beam, which was used for phase determination. The crystals belonged to space group <em>P</em>2<sub>1</sub> with unit cell parameter a~44, b~60, c~60 Å, β~100°.</p>
Raw diffraction images of H+/Ca2+ exchanger CAX (phasing data by Hg-MAD)
<p>Diffraction images of mercury-bound H<sup>+</sup>/Ca<sup>2+</sup> exchanger from <em>Archaeoglobus fulgidus</em>. This phase information was used for a PDB entry <a href="https://www.rcsb.org/structure/4KPP">4KPP</a> (<a href="http://science.sciencemag.org/content/341/6142/168">Nishizawa et al. 2013</a>). All data were collected from loop-harvested crystals on BL32XU, SPring-8 at wavelengths of 1.00000 Å (peak), 1.00930 Å (edge), or 1.01300 Å (low remote) using the MX225HE CCD detector.</p> <p>From a mercury-derivatised crystal, helical (360°/crystal, 1°/frame) datasets were collected using 5×1 μm<sup>2</sup> beam. The crystal belonged to space group <em>P</em>2<sub>1</sub> with unit cell parameter a~64, b~98, c~72 Å, β~99°.</p>
ScienceDex guides
Understand access before you commit
These curated guides explain access requirements, typical timelines, costs, and reuse considerations for widely used research datasets.
Allen Brain Atlas
Allen Brain Atlas is an Allen Institute collection of brain map atlases, datasets, APIs, and analysis tools covering mouse, human, and non-human primate brain resources.
Annotated Behaviour and Observability Dataset (ABODe)
ABODe is a University of Edinburgh DataShare dataset for behavior classification in group-housed mice using home-cage video, identities, bounding boxes, ground-plate positions, and annotator labels.
DANDI Archive for NWB datasets
DANDI is a BRAIN Initiative archive for publishing and sharing neurophysiology data, including electrophysiology, optophysiology, and behavioral data packaged as NWB and related standards.
International Brain Laboratory public data
The International Brain Laboratory public data releases expose standardized mouse decision-making experiments, including Neuropixels recordings, widefield calcium imaging, behavior, and session metadata accessed through the ONE API.
OpenNeuro
OpenNeuro is a free, open platform for sharing neuroimaging datasets, with public search, dataset pages, and download paths for web, S3, DataLad, and the OpenNeuro CLI.