Skip to main content
Powered by ShareScore

Find research datasets worth reusing

Search datasets from major research repositories and use ShareScore to quickly assess how well each record supports discovery, access, and reuse.

226

datasets available to search

ShareScore release 0.9.0

Reset

Dataset results

226 results for “X-Ray diffraction”

Learn how ShareScore rates datasets ↗
zenodo16/100

X-Ray diffraction images for a selenomethionyl derivative crystal of a Schistosoma japonicum Glutathione S-transferase expression tag

<p>Diffraction data were collected at beam line 24-ID-E of the Advanced Photon Source. This archive includes input and output files of the XDS data reduction program. Draft atomic coordinates have been deposited in the Protein Data Bank as entry&nbsp;6N8U.</p> <p>Expected amino acid sequence:</p> <pre><code>MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSSMGSSHHHHHHSSGLVPR</code></pre> <p>&nbsp;</p>

restrictedNov 2018View details →
zenodo12/100

Small-angle X-ray scattering and small-angle X-ray diffraction data for myelin proteolipid protein (PLP) and DM20 with detergent and lipids

<p>Size-exclusion chromatography - small-angle X-ray scattering (SEC-SAXS) data frames for myelin proteolipid protein (PLP) and its shorter form DM20 in complex with <em>n-</em>decyl<em>-</em>&beta;-D<em>-</em>maltopyranoside and small-angle X-ray diffraction data for PLP/DM20 membrane stacks with varying protein-to-lipid ratio and lipid composition collected at EMBL beamline P12, at PETRA-III (Hamburg). &nbsp; &nbsp;</p>

restrictedMar 2022View details →
zenodo8/100

NaOsO3 micropillar X-ray diffraction at SLS (MS) 29 Oct 2021

<p>NaOsO3 micropillar X-ray diffraction at SLS (MS)&nbsp; 29 Oct 2021</p> <p>Micropillars prepared by J. Reuteler with ScopeM FIB facilities (Sept- Oct 2021)</p>

restrictedOct 2021View details →
zenodo8/100

2.60 Å resolution X-ray diffraction data of Vibrio alkaline phosphatase, crystallised in 1.0 M KBr

<p>2.60 &Aring; anomalous&nbsp;X-ray diffraction data collected from&nbsp;a&nbsp;<em>Vibrio&nbsp;</em>alkaline phosphatase crystal grown in 1.0 M KBr. The data was collected at the P14 beamline (DESY, Hamburg) using an X-ray wavelength of 0.918 &Aring; (13.5 keV). The data set includes the raw diffraction images (&quot;AP-VAPKBr-D3_4_00001.zip&quot;), processed unmerged reflections (&quot;KBr_D6-3anom.hkl&quot;), refined coordinates and electoron density (&quot;VAPKBr_D3_refine_12.pdb&quot; and &quot;VAPKBr_D3_refine_12.mtz&quot;), an anomalous CCP4 format map derived from the data (&quot;VAPKBr_D3_map_coeffs_anom.ccp4&quot;) and XDS and XSCALE processing files.</p>

restrictedJul 2022View details →
zenodo8/100

2.52 Å crystal X-ray diffraction dataset and processing files: mCNPase V318I mutant, tetragonal crystal form

<p>2.52 &Aring; X-ray diffraction data set of mouse CNPase phosphodiesterase domain, mutant V318I, tetragonal crystal form. Data were collected on the ID30A-3&nbsp;beamline at the Europian Synchrotron Radiation Facility (ESRF). Also includes the XDS.INP and XSCALE.INP files used for data processing in XDS and XSCALE, processing results (XSCALE.LP) and the processed reflection file (CNP_11manual.HKL).</p>

restrictedAug 2021View details →
zenodo8/100

1.66 Å crystal X-ray diffraction dataset and processing files: mCNPase V318I mutant, monoclinic crystal form

<p>1.66 &Aring; X-ray diffraction data set of mouse CNPase phosphodiesterase domain, mutant V318I, monoclinic crystal form. Data were collected on the ID30A-3&nbsp;beamline at the Europian Synchrotron Radiation Facility (ESRF). Also includes the XDS.INP and XSCALE.INP files used for data processing in XDS and XSCALE, processing results (XSCALE.LP) and the processed reflection file (CNP_17manual.HKL).</p>

restrictedAug 2021View details →

ScienceDex guides

Understand access before you commit

These curated guides explain access requirements, typical timelines, costs, and reuse considerations for widely used research datasets.

Compare curated datasets

Allen Brain Atlas

Allen Brain Atlas is an Allen Institute collection of brain map atlases, datasets, APIs, and analysis tools covering mouse, human, and non-human primate brain resources.

allen-brain-atlas
neuroscienceopenDocumentation, web resources, and API references are available online.
Last verified 2026-04-30Open record

Annotated Behaviour and Observability Dataset (ABODe)

ABODe is a University of Edinburgh DataShare dataset for behavior classification in group-housed mice using home-cage video, identities, bounding boxes, ground-plate positions, and annotator labels.

abode-home-cage
behavioral-neuroscienceopenThe DataShare record exposes download links for annotations, documentation, license text, and the zipped per-snippet data directory.
Last verified 2026-04-30Open record

DANDI Archive for NWB datasets

DANDI is a BRAIN Initiative archive for publishing and sharing neurophysiology data, including electrophysiology, optophysiology, and behavioral data packaged as NWB and related standards.

dandi-nwb
electrophysiologyopenPublished Dandiset metadata and archive endpoints are available through the production DANDI API.
Last verified 2026-04-30Open record

International Brain Laboratory public data

The International Brain Laboratory public data releases expose standardized mouse decision-making experiments, including Neuropixels recordings, widefield calcium imaging, behavior, and session metadata accessed through the ONE API.

ibl
behavioral-neuroscienceopenPublic sessions can be searched and loaded from the IBL public data server through ONE.
Last verified 2026-04-29Open record

OpenNeuro

OpenNeuro is a free, open platform for sharing neuroimaging datasets, with public search, dataset pages, and download paths for web, S3, DataLad, and the OpenNeuro CLI.

openneuro
neuroscienceopenPublished datasets are available on demand over the internet.
Last verified 2026-04-29Open record