Find research datasets worth reusing
Search datasets from major research repositories and use ShareScore to quickly assess how well each record supports discovery, access, and reuse.
226
datasets available to search
ShareScore release 0.9.0
Dataset results
226 results for “X-ray Diffraction”
X-Ray diffraction images for a selenomethionyl derivative crystal of a Schistosoma japonicum Glutathione S-transferase expression tag
<p>Diffraction data were collected at beam line 24-ID-E of the Advanced Photon Source. This archive includes input and output files of the XDS data reduction program. Draft atomic coordinates have been deposited in the Protein Data Bank as entry 6N8U.</p> <p>Expected amino acid sequence:</p> <pre><code>MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSSMGSSHHHHHHSSGLVPR</code></pre> <p> </p>
Small-angle X-ray scattering and small-angle X-ray diffraction data for myelin proteolipid protein (PLP) and DM20 with detergent and lipids
<p>Size-exclusion chromatography - small-angle X-ray scattering (SEC-SAXS) data frames for myelin proteolipid protein (PLP) and its shorter form DM20 in complex with <em>n-</em>decyl<em>-</em>β-D<em>-</em>maltopyranoside and small-angle X-ray diffraction data for PLP/DM20 membrane stacks with varying protein-to-lipid ratio and lipid composition collected at EMBL beamline P12, at PETRA-III (Hamburg). </p>
NaOsO3 micropillar X-ray diffraction at SLS (MS) 29 Oct 2021
<p>NaOsO3 micropillar X-ray diffraction at SLS (MS) 29 Oct 2021</p> <p>Micropillars prepared by J. Reuteler with ScopeM FIB facilities (Sept- Oct 2021)</p>
2.60 Å resolution X-ray diffraction data of Vibrio alkaline phosphatase, crystallised in 1.0 M KBr
<p>2.60 Å anomalous X-ray diffraction data collected from a <em>Vibrio </em>alkaline phosphatase crystal grown in 1.0 M KBr. The data was collected at the P14 beamline (DESY, Hamburg) using an X-ray wavelength of 0.918 Å (13.5 keV). The data set includes the raw diffraction images ("AP-VAPKBr-D3_4_00001.zip"), processed unmerged reflections ("KBr_D6-3anom.hkl"), refined coordinates and electoron density ("VAPKBr_D3_refine_12.pdb" and "VAPKBr_D3_refine_12.mtz"), an anomalous CCP4 format map derived from the data ("VAPKBr_D3_map_coeffs_anom.ccp4") and XDS and XSCALE processing files.</p>
2.52 Å crystal X-ray diffraction dataset and processing files: mCNPase V318I mutant, tetragonal crystal form
<p>2.52 Å X-ray diffraction data set of mouse CNPase phosphodiesterase domain, mutant V318I, tetragonal crystal form. Data were collected on the ID30A-3 beamline at the Europian Synchrotron Radiation Facility (ESRF). Also includes the XDS.INP and XSCALE.INP files used for data processing in XDS and XSCALE, processing results (XSCALE.LP) and the processed reflection file (CNP_11manual.HKL).</p>
1.66 Å crystal X-ray diffraction dataset and processing files: mCNPase V318I mutant, monoclinic crystal form
<p>1.66 Å X-ray diffraction data set of mouse CNPase phosphodiesterase domain, mutant V318I, monoclinic crystal form. Data were collected on the ID30A-3 beamline at the Europian Synchrotron Radiation Facility (ESRF). Also includes the XDS.INP and XSCALE.INP files used for data processing in XDS and XSCALE, processing results (XSCALE.LP) and the processed reflection file (CNP_17manual.HKL).</p>
ScienceDex guides
Understand access before you commit
These curated guides explain access requirements, typical timelines, costs, and reuse considerations for widely used research datasets.
Allen Brain Atlas
Allen Brain Atlas is an Allen Institute collection of brain map atlases, datasets, APIs, and analysis tools covering mouse, human, and non-human primate brain resources.
Annotated Behaviour and Observability Dataset (ABODe)
ABODe is a University of Edinburgh DataShare dataset for behavior classification in group-housed mice using home-cage video, identities, bounding boxes, ground-plate positions, and annotator labels.
DANDI Archive for NWB datasets
DANDI is a BRAIN Initiative archive for publishing and sharing neurophysiology data, including electrophysiology, optophysiology, and behavioral data packaged as NWB and related standards.
International Brain Laboratory public data
The International Brain Laboratory public data releases expose standardized mouse decision-making experiments, including Neuropixels recordings, widefield calcium imaging, behavior, and session metadata accessed through the ONE API.
OpenNeuro
OpenNeuro is a free, open platform for sharing neuroimaging datasets, with public search, dataset pages, and download paths for web, S3, DataLad, and the OpenNeuro CLI.