Find research datasets worth reusing
Search datasets from major research repositories and use ShareScore to quickly assess how well each record supports discovery, access, and reuse.
57
datasets available to search
ShareScore release 0.9.0
Dataset results
57 results for “Schistosoma japonicum”
Transcriptional profiles of adult Schistosoma japonicum in response to insulin
GEO Series GSE13891. Schistosoma mansoni; Schistosoma japonicum. 28 samples. Type: Expression profiling by array.
Comparative analysis of transcriptional profiles of adult Schistosoma japonicum from different laboratory animals and the natural host, water buffalo
GEO Series GSE65327. Schistosoma japonicum. 24 samples. Type: Expression profiling by array.
Examine strain and gender associated gene expression in Schistosoma japonicum
GEO Series GSE5234. Schistosoma mansoni; Schistosoma japonicum. 12 samples. Type: Expression profiling by array.
Schistosoma japonicum differentially expressed gene at different development stage
GEO Series GSE2474. Schistosoma japonicum. 8 samples. Type: Expression profiling by array.
Murine splenic macrophage Cells: Control mice vs. Schistosoma japonicum-infected mice
GEO Series GSE46719. Mus musculus. 10 samples. Type: Expression profiling by array.
m6A RNA modification controls reproductive development and metabolic adaptation in the human parasite Schistosoma japonicum [m6a-seq]
GEO Series GSE306705. Schistosoma japonicum. 18 samples. Type: Other.
Transcriptional profiling and functional characterization of Schistosoma japonicum-stimulated Alternatively Activated Macrophages
GEO Series GSE32621. Mus musculus. 4 samples. Type: Expression profiling by array.
Longitudinal Immune Profiling Highlights CD4+ T cell Exhaustion Correlated with Liver Fibrosis in Schistosoma japonicum Infection
GEO Series GSE193216. Mus musculus. 15 samples. Type: Expression profiling by high throughput sequencing.
Microtus fortis liver RNA-Seq during Schistosoma japonicum infection
GEO Series GSE101654. Alexandromys fortis. 18 samples. Type: Expression profiling by high throughput sequencing.
Comparative microRNA expression profiles of Schistosoma japonicum from SCID mouse and BALB/c mouse
GEO Series GSE122318. Schistosoma japonicum. 4 samples. Type: Non-coding RNA profiling by high throughput sequencing.
miRNAs expression in murine liver during Schistosoma japonicum infection
GEO Series GSE134866. Mus musculus. 2 samples. Type: Non-coding RNA profiling by array.
Mice liver RNA-Seq during Schistosoma japonicum infection
GEO Series GSE101656. Mus musculus. 18 samples. Type: Expression profiling by high throughput sequencing.
Schistosoma japonicum gender-associated differentially expressed genes
GEO Series GSE3641. Schistosoma japonicum. 4 samples. Type: Expression profiling by array.
Gene transcription profiles of spleen dentritic cells in mice infected with Schistosoma japonicum in N day, 28 day, 63 day
GEO Series GSE79713. Mus musculus. 3 samples. Type: Expression profiling by array.
MicroRNA expression profile in splenic B cells of C57BL/6 mice in the late phase of Schistosoma japonicum infection
GEO Series GSE115443. Mus musculus. 6 samples. Type: Non-coding RNA profiling by array.
X-Ray diffraction images for a selenomethionyl derivative crystal of a Schistosoma japonicum Glutathione S-transferase expression tag
<p>Diffraction data were collected at beam line 24-ID-E of the Advanced Photon Source. This archive includes input and output files of the XDS data reduction program. Draft atomic coordinates have been deposited in the Protein Data Bank as entry 6N8U.</p> <p>Expected amino acid sequence:</p> <pre><code>MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSSMGSSHHHHHHSSGLVPR</code></pre> <p> </p>
m6A RNA modification controls reproductive development and metabolic adaptation in the human parasite Schistosoma japonicum [RNA-seq]
GEO Series GSE306704. Schistosoma japonicum. 4 samples. Type: Expression profiling by high throughput sequencing.
ScienceDex guides
Understand access before you commit
These curated guides explain access requirements, typical timelines, costs, and reuse considerations for widely used research datasets.
Allen Brain Atlas
Allen Brain Atlas is an Allen Institute collection of brain map atlases, datasets, APIs, and analysis tools covering mouse, human, and non-human primate brain resources.
Annotated Behaviour and Observability Dataset (ABODe)
ABODe is a University of Edinburgh DataShare dataset for behavior classification in group-housed mice using home-cage video, identities, bounding boxes, ground-plate positions, and annotator labels.
DANDI Archive for NWB datasets
DANDI is a BRAIN Initiative archive for publishing and sharing neurophysiology data, including electrophysiology, optophysiology, and behavioral data packaged as NWB and related standards.
International Brain Laboratory public data
The International Brain Laboratory public data releases expose standardized mouse decision-making experiments, including Neuropixels recordings, widefield calcium imaging, behavior, and session metadata accessed through the ONE API.
OpenNeuro
OpenNeuro is a free, open platform for sharing neuroimaging datasets, with public search, dataset pages, and download paths for web, S3, DataLad, and the OpenNeuro CLI.