Skip to main content
Powered by ShareScore

Find research datasets worth reusing

Search datasets from major research repositories and use ShareScore to quickly assess how well each record supports discovery, access, and reuse.

57

datasets available to search

ShareScore release 0.9.0

Reset

Dataset results

57 results for “Schistosoma japonicum”

Learn how ShareScore rates datasets ↗
geo20/100

Transcriptional profiles of adult Schistosoma japonicum in response to insulin

GEO Series GSE13891. Schistosoma mansoni; Schistosoma japonicum. 28 samples. Type: Expression profiling by array.

openGEO-OpenDec 2008View details →
geo20/100

Comparative analysis of transcriptional profiles of adult Schistosoma japonicum from different laboratory animals and the natural host, water buffalo

GEO Series GSE65327. Schistosoma japonicum. 24 samples. Type: Expression profiling by array.

openGEO-OpenJul 2015View details →
geo20/100

Examine strain and gender associated gene expression in Schistosoma japonicum

GEO Series GSE5234. Schistosoma mansoni; Schistosoma japonicum. 12 samples. Type: Expression profiling by array.

openGEO-OpenJul 2006View details →
geo16/100

Schistosoma japonicum differentially expressed gene at different development stage

GEO Series GSE2474. Schistosoma japonicum. 8 samples. Type: Expression profiling by array.

openGEO-OpenMar 2009View details →
geo16/100

Murine splenic macrophage Cells: Control mice vs. Schistosoma japonicum-infected mice

GEO Series GSE46719. Mus musculus. 10 samples. Type: Expression profiling by array.

openGEO-OpenMay 2013View details →
geo16/100

m6A RNA modification controls reproductive development and metabolic adaptation in the human parasite Schistosoma japonicum [m6a-seq]

GEO Series GSE306705. Schistosoma japonicum. 18 samples. Type: Other.

openGEO-OpenSep 2025View details →
geo16/100

Transcriptional profiling and functional characterization of Schistosoma japonicum-stimulated Alternatively Activated Macrophages

GEO Series GSE32621. Mus musculus. 4 samples. Type: Expression profiling by array.

openGEO-OpenOct 2011View details →
geo16/100

Longitudinal Immune Profiling Highlights CD4+ T cell Exhaustion Correlated with Liver Fibrosis in Schistosoma japonicum Infection

GEO Series GSE193216. Mus musculus. 15 samples. Type: Expression profiling by high throughput sequencing.

openGEO-OpenNov 2022View details →
geo16/100

Microtus fortis liver RNA-Seq during Schistosoma japonicum infection

GEO Series GSE101654. Alexandromys fortis. 18 samples. Type: Expression profiling by high throughput sequencing.

openGEO-OpenOct 2020View details →
geo16/100

Comparative microRNA expression profiles of Schistosoma japonicum from SCID mouse and BALB/c mouse

GEO Series GSE122318. Schistosoma japonicum. 4 samples. Type: Non-coding RNA profiling by high throughput sequencing.

openGEO-OpenNov 2020View details →
geo16/100

miRNAs expression in murine liver during Schistosoma japonicum infection

GEO Series GSE134866. Mus musculus. 2 samples. Type: Non-coding RNA profiling by array.

openGEO-OpenJul 2019View details →
geo16/100

Mice liver RNA-Seq during Schistosoma japonicum infection

GEO Series GSE101656. Mus musculus. 18 samples. Type: Expression profiling by high throughput sequencing.

openGEO-OpenOct 2020View details →
geo16/100

Schistosoma japonicum gender-associated differentially expressed genes

GEO Series GSE3641. Schistosoma japonicum. 4 samples. Type: Expression profiling by array.

openGEO-OpenMar 2012View details →
geo16/100

Gene transcription profiles of spleen dentritic cells in mice infected with Schistosoma japonicum in N day, 28 day, 63 day

GEO Series GSE79713. Mus musculus. 3 samples. Type: Expression profiling by array.

openGEO-OpenMar 2016View details →
geo16/100

MicroRNA expression profile in splenic B cells of C57BL/6 mice in the late phase of Schistosoma japonicum infection

GEO Series GSE115443. Mus musculus. 6 samples. Type: Non-coding RNA profiling by array.

openGEO-OpenJun 2021View details →
zenodo16/100

X-Ray diffraction images for a selenomethionyl derivative crystal of a Schistosoma japonicum Glutathione S-transferase expression tag

<p>Diffraction data were collected at beam line 24-ID-E of the Advanced Photon Source. This archive includes input and output files of the XDS data reduction program. Draft atomic coordinates have been deposited in the Protein Data Bank as entry&nbsp;6N8U.</p> <p>Expected amino acid sequence:</p> <pre><code>MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSSMGSSHHHHHHSSGLVPR</code></pre> <p>&nbsp;</p>

restrictedNov 2018View details →
geo12/100

m6A RNA modification controls reproductive development and metabolic adaptation in the human parasite Schistosoma japonicum [RNA-seq]

GEO Series GSE306704. Schistosoma japonicum. 4 samples. Type: Expression profiling by high throughput sequencing.

openGEO-OpenSep 2025View details →

ScienceDex guides

Understand access before you commit

These curated guides explain access requirements, typical timelines, costs, and reuse considerations for widely used research datasets.

Compare curated datasets

Allen Brain Atlas

Allen Brain Atlas is an Allen Institute collection of brain map atlases, datasets, APIs, and analysis tools covering mouse, human, and non-human primate brain resources.

allen-brain-atlas
neuroscienceopenDocumentation, web resources, and API references are available online.
Last verified 2026-04-30Open record

Annotated Behaviour and Observability Dataset (ABODe)

ABODe is a University of Edinburgh DataShare dataset for behavior classification in group-housed mice using home-cage video, identities, bounding boxes, ground-plate positions, and annotator labels.

abode-home-cage
behavioral-neuroscienceopenThe DataShare record exposes download links for annotations, documentation, license text, and the zipped per-snippet data directory.
Last verified 2026-04-30Open record

DANDI Archive for NWB datasets

DANDI is a BRAIN Initiative archive for publishing and sharing neurophysiology data, including electrophysiology, optophysiology, and behavioral data packaged as NWB and related standards.

dandi-nwb
electrophysiologyopenPublished Dandiset metadata and archive endpoints are available through the production DANDI API.
Last verified 2026-04-30Open record

International Brain Laboratory public data

The International Brain Laboratory public data releases expose standardized mouse decision-making experiments, including Neuropixels recordings, widefield calcium imaging, behavior, and session metadata accessed through the ONE API.

ibl
behavioral-neuroscienceopenPublic sessions can be searched and loaded from the IBL public data server through ONE.
Last verified 2026-04-29Open record

OpenNeuro

OpenNeuro is a free, open platform for sharing neuroimaging datasets, with public search, dataset pages, and download paths for web, S3, DataLad, and the OpenNeuro CLI.

openneuro
neuroscienceopenPublished datasets are available on demand over the internet.
Last verified 2026-04-29Open record