Find research datasets worth reusing
Search datasets from major research repositories and use ShareScore to quickly assess how well each record supports discovery, access, and reuse.
11,745
datasets available to search
ShareScore release 0.9.0
Dataset results
11,745 results for “Disorder”
Data - A Pre-Diagnostic Tool for Familial Mediterranean Fever a Rare Genetic Disorder
<div> <p>Raw data relating the paper titled A Pre-Diagnostic Tool for Familial Mediterranean Fever a Rare Genetic Disorder.</p> <p> </p> </div>
Supplementary tables for: CHAS, a deconvolution tool, infers cell type-specific signatures in bulk brain histone acetylation studies of brain disorders
<p>Supplementary tables for: CHAS, a deconvolution tool, infers cell type-specific signatures in bulk brain histone acetylation studies of brain disorders. </p> <p>Supplementary Table 1: S1_AD_H3K27ac_Marzi2018_CHAS_analysis.xls, includes the sample metadata, differentially acetylated regions when controlling for CHAS scores and CHAS-MF cell type proportions, GO enrichment analysis results using the two sets of differentially acetylated regions. </p> <p>Supplementary Table 2: S2_PD_H3K27ac_Toker2022_CHAS_analysis.xls, includes the sample metadata, differentially acetylated regions when controlling for CHAS scores and CHAS-MF cell type proportions.</p> <p>Supplementary Table 3: S3_ASD_H3K27ac_Sun2016_CHAS_analysis.xls, includes the sample metadata, differentially acetylated regions when controlling for CHAS scores and CHAS-MF cell type proportions for the prefrontal cortex and the cerebellum, GO enrichment analysis results using the two sets of differentially acetylated regions in the prefrontal cortex. </p> <p>Supplementary Table 4: S4_SCZ_BPD_H3K27ac_Girdhar2022_CHAS_analysis.xls, includes the sample metadata, differentially acetylated regions when controlling for CHAS scores and CHAS-MF cell type proportions, GO enrichment analysis results using the two sets of differentially acetylated regions. </p> <p> </p> <p> </p> <p> </p> <p> </p>
Whole genome RNA-sequencing reveals modulation of genes related to brain disorders by Withania somnifera in human neuroblastoma SK-N-SH cells
<p>Table S1: Human reference genome based differential gene expression; Figure S1: Reactome Pathway (50 μg/mL_3h vs C_3h); Figure S2: Reactome Pathway (50 μg/mL_9h vs C_9h); Figure S3: Reactome pathway (100 μg/mL_3h vs C_3h); Figure S4: GO Dose comparison; Reactome pathway (100 μg/mL_3h vs 50 μg/mL_3h); Figure S5: GO Dose comparison; Reactome pathway (100 μg/mL_9h vs 50 μg/mL_9h); Figure S6: GO Time comparison; Reactome pathway (50 μg/mL_9h vs 50 μg/mL_3h); Figure S7: GO Time comparison; Reactome pathway (100 μg/mL_9h vs 100 μg/mL_3h); Table S2: Disease ontology analysis of 100 μg/mL_3h vs 50 μg/mL_3h WS-treated SK-N-SH cells; Table S3: Disease ontology analysis of 100 μg/mL_9h vs 50 μg/mL_9h WS-treated SK-N-SH cells; Table S4: Disease ontology analysis of 100 μg/mL_9h vs 100 μg/mL_3h WS-treated SK-N-SH cells.</p>
Supplemantal tables for "A Non-targeted Proteomics Newborn Screening Platform for Genetic Disorders".
<p>Table S1 (List of proteins identified in DBS samples analyzed in the study).</p> <p>The list includes identified proteins with peptide and protein false discovery rates < 1%. Proteins shown in black are those identified by unique peptide sequences that were clearly distinguishable from others. Proteins shown in blue represent grouped master proteins. Proteins shown in grey represent grouped proteins. A quantitative value of “0” indicates that the protein was detected, but did not reach a level sufficient for quantification.</p> <p>Table S2 (Proteins identified in DBS samples that are listed in OMIM)</p> <p>List of proteins identified in every healthy newborn sample that are included in the OMIM database. The list includes identified proteins with peptide and protein false discovery rates < 1%. AD, autosomal dominant; AR, autosomal recessive; ARLOF, autosomal recessive loss of function; XL, X-linked; IUIS2022, 2022 Classification of Human Inborn Errors of Immunity by the International Union of Immunological Societies Expert Committee.</p>
The relation between childhood experiences and manifestations of borderline personality disorder. The mediating role of dissociative experiences and the moderating role of invalidating environment
<p><span>The aim of the present study is to identify the relationships between </span><span>adverse, as well as benevolent childhood experiences and specific manifestations of borderline personality disorder. </span><span>We also explored the mediating role of </span><span>dissociative experiences and the moderating role of parental invalidating environment </span><span>in the relation between </span><span>adverse, respectively benevolent childhood experiences, and specific manifestations of borderline personality disorder.</span><span> </span></p>
Figure 1 in Observations of a greater sac-winged bat pup (Saccopteryx bilineata) with a chromatic disorder
Figure 1: Saccopteryx bilineata pup in its day-roost with normal pigmentation (A). The wavy white lines are only faint and not yet pronounced like in adult bats. Photo credit: S. Ripperger. Mother-pup pair in a day roost (B). The mother is clearly distinguishable from the pup by her brown fur and the pronounced white lines on the back. Since this pup is older the faint white lines are also starting to appear on its back. Photo credit: M. Stifter.
Figure 3 in Observations of a greater sac-winged bat pup (Saccopteryx bilineata) with a chromatic disorder
Figure 3: The female pup of Saccopteryx bilineata with chromatic disorder (A). Both wing membranes, the tail membrane, and the skin showed normal colouration (B) whereas the fur was entirely white. However, some of the white hairs had black tips (C). Photo credit: S. Ripperger.
Figure 2 in Observations of a greater sac-winged bat pup (Saccopteryx bilineata) with a chromatic disorder
Figure 2: Entire isolation call from the leucistic pup. The multisyllabic call is composed of three different syllable types: (vs) variable simple syllables, end syllables which include the composite syllable type (cs) and the short stereotyped syllable type (ss). The composite syllable type is composed of two parts, a noisy part which is facultative (nc), connected to a tonal part (tc). The spectrogram depicts frequency (kHz) as a function of time and was generated using a 1042 point-fast Fourier transform with a Hamming window with 50 % overlap. Above the spectrogram, the oscillogram is depicted, displaying time on the x-axis and amplitude on the y-axis. Nomenclature follows (Fernandez and KnÖrnschild 2017).
Cell-Type Resolved Protein Atlas of Brain Lysosomes Identifies SLC45A1-Associated Disease as a Lysosomal Disorder: Untargeted Metabolomics and Lipidomics Data Deposition
<p>Raw data files used for untargeted metabolomics and lipidomics in the manuscript "Cell-Type Resolved Protein Atlas of Brain Lysosomes Identifies SLC45A1-Associated Disease as a Lysosomal Disorder".</p> <p>The PDF document <strong>(Data_Deposition_Naming_Info.pdf)</strong> contains information on the file naming system.</p>
Policing Civil Disorder in Pandemic-Driven Bulgaria
<p><span>The activity of protesters and the actions taken by the security services during protests in Bulgaria from July 9, 2020 to April 16, 2021. The analysis rests on the reports that appeared on websites and Internet portals: U.S.News, BNR Radio Bulgaria, The Sofia Globe, absNEWS, Euroactiv, Balkan Insight, DW, VESTI, Reuters, Dnevnik,<span> </span>Novini, Novinite, Dnes.dir, Nova, 24chasa and others popular websites. It was elaborated for the research project <em>Civil Disorder in Pandemic-ridden European Union</em>. The latter was financially supported by the National Science Centre, Poland [grant number 2021/43/B/HS5/00290].</span></p>
Policing Civil Disorder during the Women's Strikes in Pandemic-ridden Poland. From 22.10.2020 to 30.10.2020
<p>Policing civil disorder during the Women's Strikes in pandemic-ridden Poland on the basis the most popular opinion-forming news websites Onet.pl, RMF FM, TVN24, Rzeczpospolita, Wp.pl, Gazeta Wyborcza, Polsat News, Super Express, Dziennik Gazeta Prawna, Interia.pl, Radio Zet, TVP Info, Fakt, Money.pl, TVN in the period from 22.10.2020 to 30.10.2020. It was elaborated for the research project <em>Civil Disorder in Pandemic-ridden European Union</em>. The latter was financially supported by the National Science Centre, Poland [grant number 2021/43/B/HS5/00290].</p>
Annex to paper entitled From Collective Action to Civil Disorder: Comparative Analysis of Pandemic-ridden Czechia and Slovakia. From: March 1, 2020; To: March 1, 2022
<p>This databasis draws on ACLED DATA PROJECT. It was elaborated for the research project <em>Civil Disorder in Pandemic-ridden European Union</em>. The latter was financially supported by the National Science Centre, Poland [grant number 2021/43/B/HS5/00290].</p>
Large-scale metagenomic analysis of oral microbiomes reveals markers for autism spectrum disorders, MetaPhlAn 3 profiles
Open the record for dataset details and reuse information.
PROINFLAMMATORY AND ADIPOCYTE MARKERS AS INDICATORS OF MENSTRUAL CYCLE DISORDERS IN OVERWEIGHT ADOLESCENT GIRLS
<p>Цель: определение сывороточного содержания ключевых адипокинов и провоспалительных цитокинов у девочек-подростков с избыточной массой тела для выявления их роли в развитии нарушений менструального цикла. Материал и методы. В исследовании участвовали 50 девочек подростков, из которых в основная группа вошли 25 девочек избыточной массой тела. В контрольную группу вошли 25 девочек с нормальной массой тела. Определение сывороточных уровней адипокинов и провоспалительных цитокинов проводили методом ИФА, в соответствии с рекомендациями производителя. Результаты. Установлено, что дисбаланс адипокинов и повышенные уровни провоспалительных цитокинов связаны с нарушениями менструальной функции у подростков с избыточной массой тела. Выводы. Изученные показатели являются значимыми предикторами менструальных нарушений.</p> <p><strong><span>Ключевые слова:</span></strong><span> девочки, подростки менструальный цикл, сыворотка, цитокины, адипокины, дисбаланс.</span></p>
Data for manuscript: An all-atom view into the disordered interaction interface of the TRIM5alpha PRYSPRY domain and the HIV capsid
<p>The data is provided as a part of the manuscript "<strong>An all-atom view into the disordered interaction interface of the TRIM5alpha PRYSPRY domain and the HIV capsid</strong>". </p> <p>This repository includes an archive with folders:</p> <div> </div> <div>MDData</div> <div>-- Contains shortened versions of the MD trajectories, and initial structure files used to run simulations</div> <div> </div> <div>FigureData </div> <div>-- Contains comma separated value files for each figure</div>
Disorder predictions for all reviewed UniProt proteins with "membrane" subcellular localization
<h1>IDRs in membrane proteins</h1> <h3>About</h3> <p>The writeup below walks through how to answer the question "what fraction of membrane proteins have IDRs".</p> <p>The tl/dr: on average <strong>55% of membrane proteins [as defined here] have IDRs</strong>.</p> <h3>Data</h3> <p>This directory (WITH the associated sequences), which are not included on GitHub, are deposited on Zenodo.</p> <h2>Steps</h2> <h4>Install software</h4> <p>Install metapredict</p> <div> <pre><code>pip install metapredict</code></pre> </div> <p>Done.</p> <h4>Find the data</h4> <p>Using the "Advanced Search", I downloaded all reviewed proteins on <a href="https://uniprot.org/">UniProt</a> tagged as having a "membrane" subcellular localization.</p> <p>There are, of course, much more detailed ways one could get these data (e.g., requiring transmembrane helices, integral membrane protein filtering etc, etc), but I figured for purposes here, I'd just do this...</p> <h4>Download the data</h4> <p>From this, I downloaded all the FASTA sequences. This triggers the following file to be downloaded:</p> <div> <pre><code>uniprotkb_cc_scl_term_SL_0162_AND_revie_2024_11_09.fasta</code></pre> </div> <h4>Preprocessing the data</h4> <p>Next I wanted to fix any sequences with non-standard amino acids by converting those residues to "standard" amino acids. I did this using <code>pfasta</code>, a commandline tool that's part of <a href="https://protfasta.readthedocs.io/en/latest/">protfasta</a> which comes with metapredict.</p> <p>Did this simply with</p> <div> <pre><code>pfasta --invalid-sequence convert-all -o membrane_proteins.fasta uniprotkb_cc_scl_term_SL_0162_AND_revie_2024_11_08.fasta</code></pre> </div> <ul> <li>The <code>--invalid-sequence</code> flag tells pfasta what to with an invalid sequence, and <code>-o</code> tells it what the ouput file should be called.</li> </ul> <p>Running this (~5 seconds) generates the following output:</p> <div> <pre><code>........................ pfasta version 0.1.13+0.gc1786bd.dirty Please report bugs to: https://github.com/holehouse-lab/protfasta ........................ [INFO]: Reading in the file uniprotkb_cc_scl_term_SL_0162_AND_revie_2024_11_08.fasta [INFO]: Read in file with 1004330 lines [INFO]: Parsed file to recover 117691 sequences [INFO]: Converted 697 sequences to valid sequences [INFO]: Writing new sequence file [membrane_proteins.fasta]...</code></pre> </div> <h4>Predicting all IDRs</h4> <p>Run one of metapredict's command-line utilities to predict all IDRs in these proteins.</p> <div> <pre><code>metapredict-predict-idrs membrane_proteins.fasta -o membrane_protein_idrs.fasta</code></pre> </div> <p>This takes ~20 seconds on my desktop with an A4500 GPU or ~5 min with my Macbook Pro. We're then left with a file called <code>membrane_protein_idrs.fasta</code>. This is a FASTA file that the header format:</p> <div> <pre><code>><HEADER FOR ORIGINAL PROTEIN> IDR_START=<start position> IDR_END=<end_position></code></pre> </div> <p>e.g.</p> <div> <pre><code>>sp|B4R1D8|HH_DROSI Protein hedgehog OS=Drosophila simulans OX=7240 GN=hh PE=3 SV=1 IDR_START=0 IDR_END=94 MDNHSSVPWASAASVTCLSLDAKCHSSSSSCSSKSTASSISASPETQTMRHIAHTQRCLS RLTSLVALLLIVLPMMFSPAHSCGPGRGLGRHRA</code></pre> </div> <h3>Hacky way to get number of proteins with IDRs</h3> <p>Get the number of unique proteins in the main file:</p> <div> <pre><code>cat membrane_proteins.fasta | grep ">" | awk -F "|" {' print $2 '} | sort | uniq |wc</code></pre> </div> <p>Which returns</p> <div> <pre><code>117691 117691 829609</code></pre> </div> <p>So we have 117,691 unique proteins (NB: we could also just have gotten this without the <code>awk -F "|" {' print $2 '} | sort | uniq</code> part BUT we do need that for the number of unique proteins with IDRs so good to be consistent.</p> <div> <pre><code>cat membrane_protein_idrs.fasta | grep ">" | awk -F "|" {' print $2 '} | sort | uniq |wc</code></pre> </div> <p>Which returns</p> <div> <pre><code>64971 64971 458829 </code></pre> </div> <p>So on average <strong>55% of membrane proteins [as defined here] have IDRs</strong>.</p> <h3>Bonus!</h3> <p>In addition we can predict all disorder scores rather than discrete IDRs using</p> <div> <pre><code>metapredict-predict-disorder membrane_proteins.fasta -o membrane_protein_disorder_scores.csv</code></pre> </div> <p>This takes ~5 min on my Macbook Pro. The data for these are included here for completeness/convenience.</p>
Data supporting the findings of the study: "Neural correlates of self-other distinction in patients with schizophrenia spectrum disorders: The roles of agency and hand identity"
<p>Data supporting the findings of the study. Details are specified in the readme file.</p>
Data for "A method for intuitively extracting macromolecular dynamics from structural disorder"
<p>Analyses associated with the manuscript "A method for intuitively extracting macromolecular dynamics from structural disorder".</p>
data set related to article Suicidal ideation and suicidal attempts in referred adolescents with high functioning autism spectrum disorder and comorbid bipolar disorder: A pilot study
<p>This record contains raw data related to article Suicidal ideation and suicidal attempts in referred adolescents with high functioning autism spectrum disorder and comorbid bipolar disorder: A pilot study</p>
Assessment of insight in hospitalized neurological patient: Cognitive profile and mood disorder
<p>Purpose:Many studies have evaluated the characteristics of insight, especially in psychiatric patient pop-ulations. However, this construct has been poorly examined within neurological disorders. We exploredthe relationship between altered insight, mood disorders and neurocognitive functioning in a sample ofpatients admitted to a neurological rehabilitation unit.Method:Each patient, at the time of hospitalization (T0), underwent an evaluation of the overall cogni-tive profile, of the frontal functions, and the compilation of scales aimed at investigating the 4 domainsunder examination of insight and anxiety-depressive symptomatology. After 3 months (T1), at the end ofthe rehabilitative and supportive treatment, the patients underwent the same evaluation performed atT0.Results:Our results showed significant differences between T0 and T1 in the variables examined relatedto insight. In particular, there was a correlation between the global cognitive profile, including executivefunctions, and all insight domains. This confirms how the degree of cognitive deficit, especially of exec-utive type, affects all levels of awareness of the individual.We have also found correlations between mood disorders and insight. In particular, our results showthat depression versus anxiety plays a fundamental role in a person’s awareness.Conclusions:The study of insight is fundamental not only for the relapses it could have on the patient, butalso on those to health care professionals. In fact, having an adequate insight could lead to a greater moti-vation of the patient to be more complimentary to pharmacological and rehabilitative therapies, alsofavoring social reintegration.</p>
ScienceDex guides
Understand access before you commit
These curated guides explain access requirements, typical timelines, costs, and reuse considerations for widely used research datasets.
Allen Brain Atlas
Allen Brain Atlas is an Allen Institute collection of brain map atlases, datasets, APIs, and analysis tools covering mouse, human, and non-human primate brain resources.
Annotated Behaviour and Observability Dataset (ABODe)
ABODe is a University of Edinburgh DataShare dataset for behavior classification in group-housed mice using home-cage video, identities, bounding boxes, ground-plate positions, and annotator labels.
DANDI Archive for NWB datasets
DANDI is a BRAIN Initiative archive for publishing and sharing neurophysiology data, including electrophysiology, optophysiology, and behavioral data packaged as NWB and related standards.
International Brain Laboratory public data
The International Brain Laboratory public data releases expose standardized mouse decision-making experiments, including Neuropixels recordings, widefield calcium imaging, behavior, and session metadata accessed through the ONE API.
OpenNeuro
OpenNeuro is a free, open platform for sharing neuroimaging datasets, with public search, dataset pages, and download paths for web, S3, DataLad, and the OpenNeuro CLI.