Find research datasets worth reusing
Search datasets from major research repositories and use ShareScore to quickly assess how well each record supports discovery, access, and reuse.
167
datasets available to search
ShareScore release 0.9.0
Dataset results
167 results for “x-ray imaging”
FIGURE 9. X-ray images showing internal structures. A in The test architecture of Clypeaster (Echinoidea, Clypeasteroida) and its phylogenetic significance
FIGURE 9. X-ray images showing internal structures. A, Clypeaster telurus Clark, 1914; NHM 1953.1.24.34. B, Clypeaster subdepressus (Gray, 1825); NHM 1962.7.2.11. C, Clypeaster rarispinus de Meijere, 1902; NHM 1968.12.6.69. D, Clypeaster humilis Leske, 1778; NHM EE14009. E, Clypeaster ravenelii (Agassiz, 1869); NHM 1937.5.9.18. F, Clypeaster annandalei Koehler, 1922; NHM 1948.12.9.122. Not to scale.
FIGURE 4. Terminal leaflet images obtained through X-Ray. A in A New Species of Eriosema (Leguminosae, Papilionoideae, Phaseoleae) from the savannas of northern South America
FIGURE 4. Terminal leaflet images obtained through X-Ray. A) Eriosema parvifolium. B–C) Eriosema crinitum var. stipulare. D) Eriosema crinitum var. crinitum (X-ray images taken by Danilo S. Gissi).
Classification of Ankle Injury Observed With X-ray Combined With Magnetic Resonance Imaging
ClinicalTrials.gov study NCT02971943. IPD Sharing: UNDECIDED. Countries: 0. Publications: 0.
Computer-Aided diagnostic for classifying Chest X-Ray Images Using Deep Ensemble Learning
<p>Both healthy and tuberculosis images are from "Tuberculosis (TB) Chest X-Ray Database'' collected by researchers from Qatar and Dhaka University, Doha, Qatar, and collaboration with doctors from Hamad Medical Corporation and Bangladesh. All the images are CRX in PNG format and a size 512x512. </p> <p>The COVID and Pneumonia images are also from a Kaggle dataset: "COVID-19 Radiography Database'' , which collects images from different sources. This dataset was collected by the same researchers as the "Tuberculosis (TB) Chest X-Ray Database''. All the images in this database are CRX in PNG format and a size 256X256.</p>
X-Ray diffraction images for a selenomethionyl derivative crystal of a Schistosoma japonicum Glutathione S-transferase expression tag
<p>Diffraction data were collected at beam line 24-ID-E of the Advanced Photon Source. This archive includes input and output files of the XDS data reduction program. Draft atomic coordinates have been deposited in the Protein Data Bank as entry 6N8U.</p> <p>Expected amino acid sequence:</p> <pre><code>MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSSMGSSHHHHHHSSGLVPR</code></pre> <p> </p>
Chest X-ray images dataset of viral and bacterial pulmonary diseases.
Open the record for dataset details and reuse information.
Masks for hands in X-Ray images
<p>Semantic segmentation masks for hands on scanned X-Rays from the RSNA Bone Age dataset.</p> <p>Mask were obtained manually using thresholding and edge detection and all masks were quality checked.</p> <p>Based on this two models (Tensormask and Efficient-UNet) were trained to obtain the masks on the full RSNA Bone Age dataset.</p> <p> </p>
ScienceDex guides
Understand access before you commit
These curated guides explain access requirements, typical timelines, costs, and reuse considerations for widely used research datasets.
Allen Brain Atlas
Allen Brain Atlas is an Allen Institute collection of brain map atlases, datasets, APIs, and analysis tools covering mouse, human, and non-human primate brain resources.
Annotated Behaviour and Observability Dataset (ABODe)
ABODe is a University of Edinburgh DataShare dataset for behavior classification in group-housed mice using home-cage video, identities, bounding boxes, ground-plate positions, and annotator labels.
DANDI Archive for NWB datasets
DANDI is a BRAIN Initiative archive for publishing and sharing neurophysiology data, including electrophysiology, optophysiology, and behavioral data packaged as NWB and related standards.
International Brain Laboratory public data
The International Brain Laboratory public data releases expose standardized mouse decision-making experiments, including Neuropixels recordings, widefield calcium imaging, behavior, and session metadata accessed through the ONE API.
OpenNeuro
OpenNeuro is a free, open platform for sharing neuroimaging datasets, with public search, dataset pages, and download paths for web, S3, DataLad, and the OpenNeuro CLI.