Find research datasets worth reusing
Search datasets from major research repositories and use ShareScore to quickly assess how well each record supports discovery, access, and reuse.
666
datasets available to search
ShareScore release 0.9.0
Dataset results
666 results for “Diffraction”
Clinical Results of Asqelio Trifocal Toric Diffractive Intraocular Lens
ClinicalTrials.gov study NCT06190925. IPD Sharing: Not stated. Countries: 1. Publications: 0.
Visual Outcomes and Patient Satisfaction After Bilateral Implantation of Non-diffractive EDOF IOL Made of a New Hydrophobic Acrylic Material
ClinicalTrials.gov study NCT05488769. IPD Sharing: NO. Countries: 1. Publications: 0.
Enhanced Photoaging Reversal Efficacy and Safety of 755nm Alexandrite Picosecond Laser with Diffractive Lens Array (DLA) in Conjunction with Integrated Skin Care for Skin Quality Improvement
ClinicalTrials.gov study NCT06818630. IPD Sharing: NO. Countries: 1. Publications: 0.
Comparison of 2 Diffractive Trifocal IOLs
ClinicalTrials.gov study NCT03748381. IPD Sharing: UNDECIDED. Countries: 1. Publications: 0.
Comparison of Two Non- Diffractive Extended Depth of Focus Intraocular Lenses
ClinicalTrials.gov study NCT06607848. IPD Sharing: NO. Countries: 1. Publications: 0.
Pilot Study With a Diffractive Trifocal IOL (POD AY 26P FineVision)
ClinicalTrials.gov study NCT02042755. IPD Sharing: NO. Countries: 1. Publications: 0.
Mediator and Pol II form diffraction-sized condensates dependent on active transcription in living stem cells
GEO Series GSE115436. Mus musculus. 16 samples. Type: Genome binding/occupancy profiling by high throughput sequencing.
Diffraction images from PDB 6ZRW
<p>Collected on 20090924 at SLS beamline X06DA-PXIII on a Mar225 detector</p>
REP related 18-mer DNA (Chom22Br) - Diffraction Data
<p>REP related 18-mer DNA (Chom22Br)</p>
REP related 18-mer DNA (Hpar1) - Diffraction data
<p>Diffraction dataset.</p>
REP related 18-mer DNA (Chom22) - Diffraction Data
<p>Diffraction dataset.</p>
Massive Compression for High Data Rate Macromolecular Crystallography: Impact on Diffraction Data and Subsequent Structural Analysis
<p>This is a dataset containing raw "uncompressed" diffraction data from test sample.</p> <p>Data are collected on a lysozyme sample at 7.5 keV for a S-SAD experiment at the AMX beamline using an EIGEr 9M detector.</p> <p>The compression used, to generate the cbf files can be derived from the filenames: </p> <p>BINx: pixel binning by a factor x</p> <p>SUMx: frame summing by a factor x </p> <p>J2Kx: JPEG2000 compression used with a factor of x</p> <p>HCOMx: Hcompress used with a scale factor x </p> <p>For example: lyso_BIN2_SUM2_HCOMP4 was compressed using 2x pixel binning + 2x frame summing + Hcompress with scale of 4. </p> <p>More information will be included after publication, in the meantime, please contact author if details about processing are required.</p> <p>All zstd tar directories contain the cbf files, ready to be processed. </p> <p>All data were collected at the AMX beamline at the NSLS-II using a DECTRIS EIGER X 9 M detector. </p>
Figs. 8, 9 in Two New Species of Aglyptinus Cockerell with Unusual Sexually Dimorphic Antennae and Diffraction Gratings (Coleoptera: Leiodidae)
Figs. 8, 9. Elytral microsculpture (26203). 8) Non-iridescent female; 9) iridescent male.
A comparative study of epitaxial InGaAsBi/InP structures using Rutherford Backscattering Spectrometry, X-ray diffraction and Photoluminescence techniques.
<p>In this work we used a combination of photoluminescence (PL), high resolution X-ray diffraction (XRD) and Rutherford backscattering spectrometry (RBS) techniques to investigate material quality and structural properties of MBE-grown InGaAsBi samples (with and without an InGaAs cap layer) with targeted bismuth composition in the 3-4% range. XRD data showed that the InGaAsBi layers are more homogenous in the uncapped samples. For the capped samples, the growth of the InGaAs capped layer at higher temperature affects the quality of the InGaAsBi layer and bismuth distribution in the growth direction. Low temperature PL exhibited multiple emission peaks; the peak energies, widths and relative intensities were used for comparative analysis of the data in line with the XRD and RBS results. RBS data at random orientation together with channelled measurements allowed both an estimation of the bismuth composition as well as analysis of the structural properties. The RBS channelling showed evidence of higher strain due to possible anti-site defects in the capped samples grown at a higher temperature. It is also suggested that the growth of the capped layer at high temperature causes deterioration of the bismuth-layer quality. The RBS analysis demonstrated evidence of a reduction of homogeneity of uncapped InGaAsBi layers with increasing bismuth concentration. The uncapped higher bismuth concentration sample showed less defined channelling dips suggesting poorer crystal quality and clustering of bismuth on the sample surface.</p>
X-Ray diffraction images for a selenomethionyl derivative crystal of a Schistosoma japonicum Glutathione S-transferase expression tag
<p>Diffraction data were collected at beam line 24-ID-E of the Advanced Photon Source. This archive includes input and output files of the XDS data reduction program. Draft atomic coordinates have been deposited in the Protein Data Bank as entry 6N8U.</p> <p>Expected amino acid sequence:</p> <pre><code>MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSSMGSSHHHHHHSSGLVPR</code></pre> <p> </p>
Multi-channel seismic reflection profiles MP06b and INS-Line1 (INSIGHT cruises) and diffraction imaging code
<p>This archive contains sections of multi-channel seismic reflection profiles MP06b and INS-Line1 (INSIGHT cruises) (pre-stack gathers, unmigrated water velocity stacks and migration velocities in SEG-Y format) and an archive containing code and processing horizons needed to generate conventional and diffraction images. Requires Madagascar 3.0, Python 3.7+, pdflatex. Please contact the author (Jonathan Ford, jford@inogs.it) if assistance is required to run the code.</p> <p> </p>
Small-angle X-ray scattering and small-angle X-ray diffraction data for myelin proteolipid protein (PLP) and DM20 with detergent and lipids
<p>Size-exclusion chromatography - small-angle X-ray scattering (SEC-SAXS) data frames for myelin proteolipid protein (PLP) and its shorter form DM20 in complex with <em>n-</em>decyl<em>-</em>β-D<em>-</em>maltopyranoside and small-angle X-ray diffraction data for PLP/DM20 membrane stacks with varying protein-to-lipid ratio and lipid composition collected at EMBL beamline P12, at PETRA-III (Hamburg). </p>
Raw diffraction images of Transportin-1 in complex with a nuclear localization signal peptide
<p>Transportin-1 is one of the nuclear transport receptors. Transportin-1 binds a PY-NLS sequence of cargo proteins and brings them into the nucleus.</p> <p>We used datasets to investigate the protocol of detecting polymorphs using Hierarchical clustering (Acta D., <em>in preparation</em>). All diffraction data of this protein crystals were collected at BL32XU, SPring-8, using an automated data collection system <em>ZOO</em>. From four crystals, datasets were collected using a continuous helical scan scheme for 720º oscillation with the following experimental parameters; Beam size: 10 µm × 15 µm, Wavelength: 1.0000 Å, Total dose/crystal: 10 MGy, Detector: EIGER X 9M (DECTRIS Co. Ltd.). All crystals belonged to space group C2 with unit cell parameters roughly corresponding to a=154.3, b=153.8, c=74.3 Å, b=101.3°.</p>
NaOsO3 micropillar X-ray diffraction at SLS (MS) 29 Oct 2021
<p>NaOsO3 micropillar X-ray diffraction at SLS (MS) 29 Oct 2021</p> <p>Micropillars prepared by J. Reuteler with ScopeM FIB facilities (Sept- Oct 2021)</p>
2.2 Å resolution anomalous diffraction data of Vibrio alkaline phosphatase, crystallised in 1.0 M NaCl
<p>2.20 Å resolution anomalous diffraction dataset for <em>Vibrio</em> alkaline phosphatase, crystallised in 1.0 M NaCl. Data were collected with an X-ray energy of 6 keV at the P14 beamline at the DESY-PETRA III synchrotron in Hamburg, Germany. This dataset was used to estimate the location of chloride ions bound to the enzyme. "NaClAnon.hkl" is the final non-merged anomalous reflection file from data processing in XDS and XSCALE.</p>
ScienceDex guides
Understand access before you commit
These curated guides explain access requirements, typical timelines, costs, and reuse considerations for widely used research datasets.
Allen Brain Atlas
Allen Brain Atlas is an Allen Institute collection of brain map atlases, datasets, APIs, and analysis tools covering mouse, human, and non-human primate brain resources.
Annotated Behaviour and Observability Dataset (ABODe)
ABODe is a University of Edinburgh DataShare dataset for behavior classification in group-housed mice using home-cage video, identities, bounding boxes, ground-plate positions, and annotator labels.
DANDI Archive for NWB datasets
DANDI is a BRAIN Initiative archive for publishing and sharing neurophysiology data, including electrophysiology, optophysiology, and behavioral data packaged as NWB and related standards.
International Brain Laboratory public data
The International Brain Laboratory public data releases expose standardized mouse decision-making experiments, including Neuropixels recordings, widefield calcium imaging, behavior, and session metadata accessed through the ONE API.
OpenNeuro
OpenNeuro is a free, open platform for sharing neuroimaging datasets, with public search, dataset pages, and download paths for web, S3, DataLad, and the OpenNeuro CLI.