Find research datasets worth reusing
Search datasets from major research repositories and use ShareScore to quickly assess how well each record supports discovery, access, and reuse.
689
datasets available to search
ShareScore release 0.9.0
Dataset results
689 results for “crystals”
Endoscopic Pilonidal Sinus Treatment With Additional Crystalized Phenol
ClinicalTrials.gov study NCT02277340. IPD Sharing: Not stated. Countries: 0. Publications: 0.
A Pilot Study on Use of Liquid Crystal Contact Thermography to Detect Early Breast Cancer
ClinicalTrials.gov study NCT03858738. IPD Sharing: Not stated. Countries: 0. Publications: 0.
Combined Solution and Crystal Methods Reveal the Electrostatic Tethers That Provide a Flexible Platform for Replication Activities in the Bacteriophage T7 Replisome
GEO Series GSE138098. Escherichia phage T7. 22 samples. Type: Genome variation profiling by high throughput sequencing.
Transcriptomic analysis of primed synovial fibroblasts from monosodium urate crystal-induced arthritis in the mouse [RNA-seq]
GEO Series GSE169050. Mus musculus. 9 samples. Type: Expression profiling by high throughput sequencing.
Transcriptomic analysis of primed synovial fibroblasts from monosodium urate crystal-induced arthritis in the mouse
GEO Series GSE169052. Mus musculus. 12 samples. Type: Expression profiling by high throughput sequencing.
Study of transcriptional effects of monosodium urate crystal (MSU) on HaCaT keratinocyte cell line.
GEO Series GSE65931. Homo sapiens. 6 samples. Type: Expression profiling by array.
Taro Raphide-Associated Proteins: Profilin, Allergens and Crystal Growth
GEO Series GSE191235. Colocasia esculenta. 4 samples. Type: Expression profiling by high throughput sequencing.
Bodhgayā, Bihār. Quartz variety rock crystal; polished hexagonal prism.
<p>Bodhgayā, Bihār. Quartz variety rock crystal; polished hexagonal prism; natural crystal form having had pointed terminal removed. British Museum 1892,1103.53 presented by Alexander Cunningham.</p> <p> </p>
Bodhgayā, Bihār. Pink tourmaline, natural unpolished crystal.
<p>Bodhgayā, Bihār. Pink tourmaline, natural unpolished crystal. British Museum 1892,1103.63 presented by Alexander Cunningham.</p>
X-Ray diffraction images for a selenomethionyl derivative crystal of a Schistosoma japonicum Glutathione S-transferase expression tag
<p>Diffraction data were collected at beam line 24-ID-E of the Advanced Photon Source. This archive includes input and output files of the XDS data reduction program. Draft atomic coordinates have been deposited in the Protein Data Bank as entry 6N8U.</p> <p>Expected amino acid sequence:</p> <pre><code>MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSSMGSSHHHHHHSSGLVPR</code></pre> <p> </p>
In-plane structural anisotropy in beta-gallium oxide single crystals
<p>GaOx_anisotropy_raw_data contains x-ray diffraction scans performed on commercial undoped and Sn-doped beta-gallium oxide wafers ((-201) oriented) grown using Edge-defined Film-fed Growth method by Tamura corporation and Si-doped beta-gallium oxide crystal ((100) oriented) grown using Optical Floating Zone technique at TIFR crystal growth facility.</p> <p>X-ray diffraction scans were performed at different phi angles to find in-plane structural anisotropy in beta-gallium oxide crystals. </p> <p>Scans were performed for (-603) plane for commercial wafers and (400) plane for lab-grown crystals.</p> <p>Rigaku Smartlab diffractometer was used to perform these scans and all data files are in .ras format.</p> <p>Scans include omega, 2theta-omega, chi, z which were performed to find exact Bragg peak at each phi. All scans performed to obtain optimized values are also present. (For Sn-doped sample, z optimization was not performed.)<br> 2theta, 2theta-theta and phi scans performed at optimized values are also present for Si-doped lab-grown sample and undoped commercial sample.</p> <p>Dataset also contains scans of Sn-doped wafer when chi optimization was not performed and can be used to compare with optimized peaks.</p> <p>Sn-doped commercial wafer scans - phi=0 to 360 with step of 15 degrees</p> <p>Si-doped lab grown crystal and undoped commercial wafer scans - phi=0 to 360 with step of 30 degrees</p>
Analysis of microRNA expression profiles in exosomes of proximal renal tubular cells in response to oxalate crystal
GEO Series GSE110509. synthetic construct; Homo sapiens. 9 samples. Type: Non-coding RNA profiling by array.
Analysis of altered LncRNA expression profiles in proximal renal tubular cells in response to calcium oxalate monohydrate crystal adhesion
GEO Series GSE57111. Homo sapiens. 2 samples. Type: Expression profiling by array; Non-coding RNA profiling by array.
Fibrinogen alpha chain promotes the formation of CaOx crystal nuclei by binding to oxalic acid
GEO Series GSE269407. Rattus norvegicus. 8 samples. Type: Expression profiling by array.
Potential Targets of Cholesterol Crystal Embolism
GEO Series GSE298484. Mus musculus. 6 samples. Type: Expression profiling by high throughput sequencing.
Numerical data sets pertaining to phase-field simulations of faceted crystal dissolution processes
<p>The numerical data in this repository (Archive.zip + Animation.zip) pertains to the simulation results of faceted crystal dissolution processes in different crystal-liquid systems. The simulations were performed using the software package named "Pace3D version 2.5.1". The software license can be purchased at Steinbeis Network (www.steinbeis.de) in the management of Britta Nestler and Michael Selzer under the subject area ‘Material Simulation and Process Optimization’. </p> <p><br> The data is organized, the way it appears in the figures in the manuscript. Thus, the folders (compressed) are named according to the figure number in the manuscript.</p> <ul> <li>For the sake of convenience, the simulation data at intermediate dissolution stages was converted from Pace3D output format (*.phiindex.p3s and *.phi_crystal.p3s) to VTK data format, that can be visualized using open source software packages like Paraview. The VTK data files in each subfolder are also compressed (*.gz). For visualization, a decompression of the data is necessary (e.g. with gzip, 7zip).</li> <li>The animation videos of the simulations are also attached as a separate compressed file named Animation.zip.</li> </ul>
Liquid Crystal Effects
<p>Liquid Crystals serve as both material, medium and method through which the film investigates the former Långban mines in Eastern Värmland in Sweden. Liquid crystals (used in LCD TV, computer and mobile screens) are forming the symbolic and material base in our common digital Technosphere. The mine’s water-filled ores, emptied of minerals, are transformed into a museum.</p>
Spectral and thermometric properties altering through crystal field strength modification and host material composition in luminescent thermometers based on Fe3+ doped AB2O4 type nanocrystals (A= Mg, Ca; B=Al, Ga)
<p>The growing interest in the use of luminescence thermometry for noncontact temperature reading in very specific conditions imposes the need to develop an approach allowing modification of the luminescence parameters of the thermometer accordingly to the requirements. Therefore, in response to these expectations, this manuscript reports an approach to modulating the spectral position and the luminescence thermal quenching rate of Fe<sup>3+</sup> ions by modifying the crystal field strength and the host material composition of nanocrystalline AB<sub>2</sub>O<sub>4</sub> type nanocrystals (A= Mg, Ca; B=Al, Ga). It was proved that in a group of MgAl<sub>2</sub>O<sub>4</sub>, MgGa<sub>2</sub>O<sub>4</sub>, CaAl<sub>2</sub>O<sub>4</sub>, and CaGa<sub>2</sub>O<sub>4</sub> nanocrystals doped with Fe<sup>3+</sup> ions the emission spectral range, as well as the relative thermal sensitivity (from 0.2%/<sup>o</sup>C for MAO to 2.07%/<sup>o</sup>C for CGO) and the operating temperature range, can be easily modified by the host material composition. For instance, a maximal relative thermal sensitivity of 2.58%/<sup>o</sup>C is obtained for Fe<sup>3+</sup>, Tb<sup>3+</sup> co-doped CaAl<sub>2</sub>O<sub>4 </sub>nanocrystals. The proposed approach is a step toward the intentional designing of the highly sensitive luminescent thermometer.</p>
A ferroelectric liquid crystal confined in cylindrical nanopores: reversible smectic layer buckling, enhanced light rotation and extremely fast electro-optically active Goldstone excitations
<p>The orientational and translational order of a thermotropic ferroelectric liquid crystal (2MBOCBC) imbibed in self-organized, parallel, cylindrical pores with radii of 10, 15, or 20 nm in anodic aluminium oxide monoliths (AAO) are explored by high-resolution linear and circular optical birefringence as well as neutron diffraction texture analysis. The results are compared to experiments on the bulk system. The native oxidic pore walls do not provide a stable smectogen wall anchoring. By contrast, a polymeric wall grafting enforcing planar molecular anchoring results in a thermal-history independent formation of smectic C* helices and a reversible chevron-like layer buckling. An enhancement of the optical rotatory power by up to one order of magnitude of the confined compared to the bulk liquid crystal is traced to the pretransitional formation of helical structures at the smectic-A*-to-smectic-C* transformation. A linear electro-optical birefringence effect evidences collective fluctuations in the molecular tilt vector direction along the confined helical superstructures, <em>i.e.</em> the Goldstone phason excitations typical of the para-to-ferroelectric transition. Their relaxation frequencies increase with the square of the inverse pore radii as characteristic of plane-wave excitations and are two orders of magnitude larger than in the bulk, evidencing an exceptionally fast electro-optical functionality of the liquid-crystalline-AAO nanohybrids.</p>
Growth of 6-inch p-type 4H-SiC single crystals with low dislocation density by physical vapor transport
Open the record for dataset details and reuse information.
ScienceDex guides
Understand access before you commit
These curated guides explain access requirements, typical timelines, costs, and reuse considerations for widely used research datasets.
Allen Brain Atlas
Allen Brain Atlas is an Allen Institute collection of brain map atlases, datasets, APIs, and analysis tools covering mouse, human, and non-human primate brain resources.
Annotated Behaviour and Observability Dataset (ABODe)
ABODe is a University of Edinburgh DataShare dataset for behavior classification in group-housed mice using home-cage video, identities, bounding boxes, ground-plate positions, and annotator labels.
DANDI Archive for NWB datasets
DANDI is a BRAIN Initiative archive for publishing and sharing neurophysiology data, including electrophysiology, optophysiology, and behavioral data packaged as NWB and related standards.
International Brain Laboratory public data
The International Brain Laboratory public data releases expose standardized mouse decision-making experiments, including Neuropixels recordings, widefield calcium imaging, behavior, and session metadata accessed through the ONE API.
OpenNeuro
OpenNeuro is a free, open platform for sharing neuroimaging datasets, with public search, dataset pages, and download paths for web, S3, DataLad, and the OpenNeuro CLI.