Find research datasets worth reusing
Search datasets from major research repositories and use ShareScore to quickly assess how well each record supports discovery, access, and reuse.
1,487
datasets available to search
ShareScore release 0.9.0
Dataset results
1,487 results for “Tagging”
RNA-sequencing data from Pseudomonas putida KT2440 wild-type and Hfq-tagged strain form co-immunoprecipitation experiment
GEO Series GSE85581. Pseudomonas putida. 12 samples. Type: Expression profiling by high throughput sequencing.
Supplementation material for "Search for $\mathrm{B}^+ \to \mathrm{K}^{*+} \tau^+\tau^-$ with hadronic tagging at the Belle II Experiment"
Open the record for dataset details and reuse information.
Figure 2 in Estimating population density of the medicinal leech Hirudo orientalis Utevsky and Trontelj, 2005 (Clitellata: Hirudinida) using Visible Implant Elastomer tags
Figure 2. Process of injecting the fluorescent dye, using an insulin syringe.
X-Ray diffraction images for a selenomethionyl derivative crystal of a Schistosoma japonicum Glutathione S-transferase expression tag
<p>Diffraction data were collected at beam line 24-ID-E of the Advanced Photon Source. This archive includes input and output files of the XDS data reduction program. Draft atomic coordinates have been deposited in the Protein Data Bank as entry 6N8U.</p> <p>Expected amino acid sequence:</p> <pre><code>MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSSMGSSHHHHHHSSGLVPR</code></pre> <p> </p>
MFishBT: A global database of biogeochemical tags in migratory fish
<p>Humans have long been fascinated by the mysteries surrounding fish migrations, and addressing these complex behaviors often requires large datasets. Biogeochemical tags, including trace elements and stable isotopes, are the most accessible biomarkers for tracking fish migrations. However, access to standardized biogeochemical tag data is rarely available for migratory fish, which limits our understanding of the evolutionary origins, drivers, timing, and corridors of migration. This precludes the development of conservation strategies and the implementation of management actions. Here, we present MFishBT, a global, open-access database of Migratory Fish’s Biogeochemical Tags. As of April 2023, the MFishBT contains biogeochemical records from 1,305 studies, of which 53% used element-to-calcium (E/Ca) ratios, 34% used isotopic ratios, and 13% used both. The database covers 17,410 field sampling locations (inland 47% vs. marine 53%) around the globe, comprising 490 migratory fish species of four classes, 44 orders/suborders, and 137 families. Seventy-seven trace elements and 11 isotope systems were measured across various fish biological archives, including otoliths, scales, eye lenses, and vertebrae. E/Ca ratios were examined more frequently than isotopic ratios, led by Sr/Ca, Mg/Ca, Ba/Ca, and 87Sr/86Sr, δ13C, and δ18O, respectively. The MFishBT compiles 27,030, 16,222, and 2,481,714 records with biogeochemical data detected in the core, edge, and core-to-edge transects for biological archives of migratory fish, respectively. This is the most globally comprehensive open-access database on biogeochemical tags in migratory fish to date, which can serve a variety of needs in scientific research, conservation, and management. We encourage researchers to add more datasets to this database in the future. This database is released for non-commercial use only. There are no copyright restrictions, and please cite this paper when using these data, or a subset of these data, for publication.</p>
Cell-type specific gene expression profiling in heterogeneous in vitro cultures using epitope-tagged RPL22
GEO Series GSE149076. Homo sapiens; Mus musculus. 7 samples. Type: Expression profiling by high throughput sequencing.
A protocol for high-throughput microplate-based CUT&Tag
GEO Series GSE308505. Homo sapiens. 155 samples. Type: Genome binding/occupancy profiling by high throughput sequencing.
RNA-Seq analysis of beta-actin knockout MEFs expressing NLS-tagged beta-actin
GEO Series GSE213433. Mus musculus. 3 samples. Type: Expression profiling by high throughput sequencing.
CUT&Tag for analysis of Nrf2-regulated genes in liver of heat-stressed chicken (Gallus gallus)
GEO Series GSE162661. Gallus gallus. 8 samples. Type: Genome binding/occupancy profiling by high throughput sequencing.
ChIP-seq of MOZ (Flag-V5-BIO tagged) in mouse mouse craniofacial development
GEO Series GSE134607. Mus musculus. 7 samples. Type: Genome binding/occupancy profiling by high throughput sequencing.
Gene expression analysis in the presence or absence of N-terminal tag (9myc) of Swd2 in Saccharomyces cerevisiae
GEO Series GSE180992. Saccharomyces cerevisiae. 4 samples. Type: Expression profiling by high throughput sequencing.
Multi-omics and machine learning reveal context-specific gene regulatory activities of PML-RARA in Acute Promyelocytic Leukemia [Cut&Tag]
GEO Series GSE209833. Homo sapiens. 2 samples. Type: Genome binding/occupancy profiling by high throughput sequencing.
3' Tag RNA-seq analysis of wild type (S. pimpinellifolium accession LA1589) and SUN NIL during tomato fruit development.
GEO Series GSE135764. Solanum pimpinellifolium. 56 samples. Type: Expression profiling by high throughput sequencing.
Transcriptional profiling of newly generated dentate granule cells using TU-tagging reveals pattern shifts in gene expression during circuit integration
GEO Series GSE76587. Mus musculus. 10 samples. Type: Expression profiling by high throughput sequencing.
Pre-occupied ATF4 relies on CEBPγ co-binding for robust transcription activation during integrated stress response [CUT&Tag]
GEO Series GSE281440. Mus musculus. 20 samples. Type: Genome binding/occupancy profiling by high throughput sequencing.
CHD7 marks TAD boundaries during neuronal differentiation [Cut & Tag]
GEO Series GSE293439. Mus musculus. 14 samples. Type: Genome binding/occupancy profiling by high throughput sequencing.
CUT&Tag profiling of JUND chromatin binding in human mast cell line LAD2 under SCF stimulation and imatinib perturbation
GEO Series GSE316333. Homo sapiens. 6 samples. Type: Genome binding/occupancy profiling by high throughput sequencing.
Inhibition of EZH2 restores normal expression of genes associated with cysteine metabolism and ferroptosis in hepatocellular carcinoma [CUT&Tag]
GEO Series GSE268195. Homo sapiens. 12 samples. Type: Genome binding/occupancy profiling by high throughput sequencing.
Transcriptomic and epigenetic profiling of adrenergic and mesenchymal neuroblastomas with cell state conversion [CUT&TAG]
GEO Series GSE299170. Homo sapiens. 0 samples. Type: Genome binding/occupancy profiling by high throughput sequencing.
Aire regulates chromatin looping by evicting CTCF from domain boundaries and favoring accumulation of cohesin on super-enhancers [CUT&Tag]
GEO Series GSE180936. Mus musculus. 4 samples. Type: Other.
ScienceDex guides
Understand access before you commit
These curated guides explain access requirements, typical timelines, costs, and reuse considerations for widely used research datasets.
Allen Brain Atlas
Allen Brain Atlas is an Allen Institute collection of brain map atlases, datasets, APIs, and analysis tools covering mouse, human, and non-human primate brain resources.
Annotated Behaviour and Observability Dataset (ABODe)
ABODe is a University of Edinburgh DataShare dataset for behavior classification in group-housed mice using home-cage video, identities, bounding boxes, ground-plate positions, and annotator labels.
DANDI Archive for NWB datasets
DANDI is a BRAIN Initiative archive for publishing and sharing neurophysiology data, including electrophysiology, optophysiology, and behavioral data packaged as NWB and related standards.
International Brain Laboratory public data
The International Brain Laboratory public data releases expose standardized mouse decision-making experiments, including Neuropixels recordings, widefield calcium imaging, behavior, and session metadata accessed through the ONE API.
OpenNeuro
OpenNeuro is a free, open platform for sharing neuroimaging datasets, with public search, dataset pages, and download paths for web, S3, DataLad, and the OpenNeuro CLI.