Find research datasets worth reusing
Search datasets from major research repositories and use ShareScore to quickly assess how well each record supports discovery, access, and reuse.
2,001
datasets available to search
ShareScore release 0.9.0
Dataset results
2,001 results for “x-rays”
Biological characteristics of gene expression features in pancreatic cancer cell induced by proton and x-ray irradiation IV
GEO Series GSE107443. Homo sapiens. 8 samples. Type: Expression profiling by array.
Radiation effects on lung carcinogenesis in neonatal, juvenile, and adult Wistar rats after thoracic X-ray irradiation
GEO Series GSE78869. Rattus norvegicus. 12 samples. Type: Genome variation profiling by genome tiling array.
Computer-Aided diagnostic for classifying Chest X-Ray Images Using Deep Ensemble Learning
<p>Both healthy and tuberculosis images are from "Tuberculosis (TB) Chest X-Ray Database'' collected by researchers from Qatar and Dhaka University, Doha, Qatar, and collaboration with doctors from Hamad Medical Corporation and Bangladesh. All the images are CRX in PNG format and a size 512x512. </p> <p>The COVID and Pneumonia images are also from a Kaggle dataset: "COVID-19 Radiography Database'' , which collects images from different sources. This dataset was collected by the same researchers as the "Tuberculosis (TB) Chest X-Ray Database''. All the images in this database are CRX in PNG format and a size 256X256.</p>
X-ray models from "An XMM-Newton spectral survey of 12 µm selected galaxies - I. X-ray data"
<p>Copied table models that used to be hosted at http://astro.ic.ac.uk/mbrightman/home</p> <p>from publication: https://ui.adsabs.harvard.edu/abs/2011MNRAS.413.1206B</p>
A comparative study of epitaxial InGaAsBi/InP structures using Rutherford Backscattering Spectrometry, X-ray diffraction and Photoluminescence techniques.
<p>In this work we used a combination of photoluminescence (PL), high resolution X-ray diffraction (XRD) and Rutherford backscattering spectrometry (RBS) techniques to investigate material quality and structural properties of MBE-grown InGaAsBi samples (with and without an InGaAs cap layer) with targeted bismuth composition in the 3-4% range. XRD data showed that the InGaAsBi layers are more homogenous in the uncapped samples. For the capped samples, the growth of the InGaAs capped layer at higher temperature affects the quality of the InGaAsBi layer and bismuth distribution in the growth direction. Low temperature PL exhibited multiple emission peaks; the peak energies, widths and relative intensities were used for comparative analysis of the data in line with the XRD and RBS results. RBS data at random orientation together with channelled measurements allowed both an estimation of the bismuth composition as well as analysis of the structural properties. The RBS channelling showed evidence of higher strain due to possible anti-site defects in the capped samples grown at a higher temperature. It is also suggested that the growth of the capped layer at high temperature causes deterioration of the bismuth-layer quality. The RBS analysis demonstrated evidence of a reduction of homogeneity of uncapped InGaAsBi layers with increasing bismuth concentration. The uncapped higher bismuth concentration sample showed less defined channelling dips suggesting poorer crystal quality and clustering of bismuth on the sample surface.</p>
Figure 2 in Trigonotarbus johnsoni Pocock, 1911, revealed by X-ray computed tomography, with a cladistic analysis of the extinct trigonotarbid arachnids
Figure 2. Hand specimens of Trigonotarbus johnsoni from the NHMUK collections. Scale bars = 1 mm.
X-Ray diffraction images for a selenomethionyl derivative crystal of a Schistosoma japonicum Glutathione S-transferase expression tag
<p>Diffraction data were collected at beam line 24-ID-E of the Advanced Photon Source. This archive includes input and output files of the XDS data reduction program. Draft atomic coordinates have been deposited in the Protein Data Bank as entry 6N8U.</p> <p>Expected amino acid sequence:</p> <pre><code>MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSSMGSSHHHHHHSSGLVPR</code></pre> <p> </p>
Applicability of an 125I-based in vivo x-ray fluorescence system in measuring skin iron
<p>The complete dataset used for the paper "Applicability of an <sup>125</sup>I-based in vivo x-ray fluorescence system in measuring skin iron" published under the journal Biomedical Physics and Engineering Express</p>
Increased X-ray sensitivity and sustained chromosomal stability in Ataxia Telangiectasia-derived induced pluripotent stem (AT-iPS) cells
GEO Series GSE47498. Homo sapiens. 5 samples. Type: SNP genotyping by SNP array.
Biological characteristics of gene expression features in pancreatic cancer cell induced by proton and x-ray irradiation II
GEO Series GSE107441. Homo sapiens. 9 samples. Type: Expression profiling by array.
Biological characteristics of gene expression features in pancreatic cancer cell induced by proton and x-ray irradiation
GEO Series GSE107444. Homo sapiens. 36 samples. Type: Expression profiling by array.
RIP-sequencing reveals that X-ray irradiation infection ELAVL1 binding RNA sites
GEO Series GSE102146. Homo sapiens. 4 samples. Type: Expression profiling by high throughput sequencing.
MSL MARS CHEMISTRY & MINERALOGY X-RAY INSTRUMENT 2 EDR V1.0
Unprocessed experiment data from the CheMin instrument aboard the Mars Science Laboratory rover.
Lymphoma transcriptome analysis after X-ray or Proton beam irradiation
GEO Series GSE143550. Mus musculus; Homo sapiens. 18 samples. Type: Expression profiling by high throughput sequencing.
lncRNA and mRNA-sequencing of WS1 cells after 5Gy of X-Ray irradiation
GEO Series GSE102145. Homo sapiens. 2 samples. Type: Expression profiling by high throughput sequencing.
Identification of AtATM-dependent X-ray inducible transcript
GEO Series GSE19252. Arabidopsis thaliana. 6 samples. Type: Expression profiling by array.
High throughput sequencing of human fibroblast WS1 cells after 5 Gy X-ray irradiation
GEO Series GSE102147. Homo sapiens. 6 samples. Type: Expression profiling by high throughput sequencing.
2 doses of ionising radiations (x-rays) -Transcriptomic analysis of effects of ionising radiation on Arabidopsis thaliana.
GEO Series GSE35942. Arabidopsis thaliana. 16 samples. Type: Expression profiling by array.
Syngergistic Anti-tumor Effects between GLA and X-ray Radiation
GEO Series GSE178553. Mus musculus. 12 samples. Type: Other.
UK Industrial X-ray CT User-group Benchmark Data: 3D Al target 08
<p>X-ray tomography (CT) image data of a aluminium target as part of the 'UK Industrial X-ray CT User-group Benchmark Study'.<br> <br> The 3D image was generated with an X-ray tomography scan performed by Dr T Lowe at the Manchester X-ray Imaging Facility.<br> <br> The dataset includes: raw radiographs; scan & reconstruction parameter settings file; reconstructed 3D volume. To visualise the 3D volume use software such as ImageJ (https://imagej.net/Fiji/Downloads). The volume image data (.raw) is in binary format and has the following characteristics: 1596 x 1596 x 950; 16-bit Signed; little-endian byte order.</p>
ScienceDex guides
Understand access before you commit
These curated guides explain access requirements, typical timelines, costs, and reuse considerations for widely used research datasets.
Allen Brain Atlas
Allen Brain Atlas is an Allen Institute collection of brain map atlases, datasets, APIs, and analysis tools covering mouse, human, and non-human primate brain resources.
Annotated Behaviour and Observability Dataset (ABODe)
ABODe is a University of Edinburgh DataShare dataset for behavior classification in group-housed mice using home-cage video, identities, bounding boxes, ground-plate positions, and annotator labels.
DANDI Archive for NWB datasets
DANDI is a BRAIN Initiative archive for publishing and sharing neurophysiology data, including electrophysiology, optophysiology, and behavioral data packaged as NWB and related standards.
International Brain Laboratory public data
The International Brain Laboratory public data releases expose standardized mouse decision-making experiments, including Neuropixels recordings, widefield calcium imaging, behavior, and session metadata accessed through the ONE API.
OpenNeuro
OpenNeuro is a free, open platform for sharing neuroimaging datasets, with public search, dataset pages, and download paths for web, S3, DataLad, and the OpenNeuro CLI.